KEGG   Mus musculus (mouse): 77739Help
Entry
77739             CDS       T01002                                 

Gene name
Adamtsl1, 5930437A14Rik, 6720426B09Rik, ADAMTSL-1
Definition
(RefSeq) ADAMTS-like 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 TSP_1 Ig_2 ig V-set PLAC ADAM_spacer1 Adeno_E3_CR1
Motif
Other DBs
NCBI-GeneID: 77739
NCBI-ProteinID: NP_084243
MGI: 1924989
Ensembl: ENSMUSG00000066113
Vega: OTTMUSG00000007395
UniProt: Q8BLI0 E9PWW5 Q9CX59
Position
4; 4 C4
AA seq 1753 aa AA seqDB search
MECCRRAAPGTPLLVLAFLLLSSRTARSEEDREGLWDAWGPWSECSRTCGGGASYSLRRC
LSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKYHGQLYEWLPVSNDPDNPCS
LKCQAKGTSLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNG
DGSTCRLVRGQYKSQLSASKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENS
LSSTGIFLVDNSTVDFQKLPDKEILRMTGPLTADFIIKIHDLGPADSTVQFIFYQPIIHR
WRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENVKPKPKLQECNLDPCP
ARWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDC
PKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSAKTKPHIKEECIIPTPCYKPRE
KLPIEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACTVTCGVGTQVRIIRCQVLLPFSQ
SVADLPADECEGPKPASQRACYAGPCNGETPEFNPDNGDGLLGGLQDLDELYDWEYEGFT
KCSESCGGGVQEAVVSCLNKQTRELADENLCVTSRRPPQLLKSCNLDPCPARWEIGKWSP
CSLTCGVGLQTRDVVCSHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPPAWYPAQW
QLCSRTCGGGIQKRDVLCKQRMADGSFLELPETFCSASKPTSHQGCKKDDCPSEWLLSEW
SECSVSCGEGTQTRSAICQRVLKTGVSTVVNSTLCPPLPFSSSIRPCMLATCARPGRPST
KHSPHIAAARNIYIQTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQH
SISSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVIKLIGGNRKLVARPLSLWSE
EEEALQVRKTNPKEALQTHKHQNGIFSNGSKAEKRGLTADPGNRYDDIVSRLLEQGGWPG
ELLASWEVQDSAERNASSEEDPNAEQALLHLPFTMVAEQKRLDDILRNLSQQPEELRDLY
SKHLVAQLAQDIFRSHLENQDLLPKPSEQRFPPMAVPAHKHVSGFSSSLRSSSGEAGGGS
RRPHRKPAILRKISAAQQLSASEVVTHLGQTVALASGTLSVLLHCEAVGNPRPTIHWTRN
GEAVQFSDRILLQPDDSLQILAPVEADVGFYTCNATNALGYDSVSIAVTLAGKPLVKTSR
MTVLNTEKPTVTVDIGGTVRTVRGVNVTINCQVAGVPEAEVTWFRNKSKLGSSHHLHEGS
SHHLHEGSLLLTDVSFSDQGLYSCRAANLHGEQTESTQLLILDPPQVPTQLEDIRALLLA
TGPNLPSVLMSPLGTQLVLDPGNSALLGCPIKGHPTPNITWFQNGQPIATAPGLTHHIWG
AGQILRVANLSGGPQGEFSCLAQNEAGTLLQKASLVIQDYWWSVDRLATCSASCGNRGIH
QPRLRCLLNTTEVDPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACTRSCGGGVQTRR
VTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQQLCVEWAFSSWGQCNGPCIGPRLAV
QHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQS
RRVECVHVRTNKAVPEHLCSWGPRPANWQRCNVTPCENTECRDTTRYCEKVRQLKLCQLG
QFRSRCCGTCGKA
NT seq 5262 nt NT seq  +upstreamnt  +downstreamnt
atggaatgctgccgtcgggcagctcctggcacaccgctgctcgttctggctttcctactc
ctgagttccaggactgcacgctcagaggaagaccgtgaaggcctctgggatgcctggggc
ccttggagcgagtgttccagaacctgtggtgggggtgcctcctattccctgagacgctgc
ctgagcagcaagagctgtgaagggagaaatattcgatatagaacatgcagtaatgtggac
tgcccaccagaagcaggtgatttccgagctcaacagtgttctgctcataacgacgtcaag
taccatggacagctttatgaatggcttcctgtatctaatgaccccgacaatccatgctca
ctcaagtgccaagcaaaaggaaccagcctggttgtggaactagcaccgaaggtcttagat
ggtacgcgatgctatacagaatcactggatatgtgcatcagcggcctatgccaaattgtt
ggctgtgatcaccagctggggagcactgtcaaagaggataactgtggagtgtgcaacgga
gatggctcaacgtgccggctggtccgagggcagtataaatctcagctctctgcaagtaaa
tcggatgacaccgtggtcgccattccttacggcagcagacacatccgccttgtcttaaaa
gggccagatcatttgtatctggagaccaagaccctccagggaactaaaggtgaaaatagt
ctgagctctacaggcattttccttgtggacaattctacagtggacttccagaaacttcca
gacaaagagatactgaggatgactgggccactgacagcagatttcatcatcaagatccat
gacttgggacctgcagacagcaccgtccagttcatcttctaccagcccatcatccaccga
tggagggaaacagacttctttccttgctcagcaacgtgtggtggaggctaccagctgacg
tctgccgagtgctatgatctacggagtaaccgtgtggtggccgaccagtactgtcactac
taccccgagaacgtcaagcccaaacccaagcttcaggagtgcaacttggatccttgtcca
gccaggtgggaggccaccccgtggaccgcgtgctcctcctcatgtggggggggcatccag
agccgggcagtttcctgtgtggaggaggacatccaggggcatgtcacttcagtggaagag
tggaaatgcatgtacaccccaaagatgccagtcgtgcagccctgcaacatttttgactgc
cctaaatggctggcacaggagtggtctccgtgcacagtgacctgtggccagggcctcaga
taccgcgtggtactctgcattgaccaccgaggaatgcacacaggaggctgcagtgctaaa
acaaagccccacataaaagaagaatgcatcattcccacaccgtgctacaagcccagagag
aaacttccaatagaggccaagctgccatggttcaagcaagcccaggagctagaggaagga
gctgcagtgtctgaagagccttcgttcatcccagaagcttggtcggcctgtactgtcacc
tgtggcgtggggacacaggtgcgaataataagatgccaggtgctcctgcctttctctcag
tctgtggctgacctgcctgcggatgaatgcgaagggcctaagccagcatcgcaacgtgcc
tgttatgcgggaccgtgcaacggggaaactccggaatttaacccggataacggagacgga
ctcttgggtggcctgcaggacctggacgagctgtatgactgggaatatgagggcttcacc
aagtgctctgagtcatgtggaggaggtgtccaggaggctgtggtaagctgcctgaacaaa
cagacccgggaactcgctgatgagaacctgtgtgtgaccagccgacggcccccgcagctc
ctgaaatcctgtaacttggatccctgcccagcaaggtgggaaattggcaagtggagccca
tgtagcctcacctgtggggttggcctgcagaccagagatgttgtctgttcccacctactc
tccagagagatgaacgaggtggttgtcctggccgatgagctgtgccatcaccccaaaccc
agcacagtgcaagcctgcaaccgtttcaattgccccccagcctggtaccctgcacagtgg
cagctgtgttccaggacctgtggaggagggattcagaaacgtgatgttctctgcaagcag
cgtatggctgacggcagcttcctggagcttccagagaccttctgttctgcctccaaacca
acctcccaccaagggtgcaagaaagatgactgccccagtgagtggcttctctcagagtgg
tcagagtgctctgtgagctgtggggagggcacccagactcgaagtgccatttgccagagg
gtgctgaaaactggggtctccactgttgtcaattctactttgtgccctcccctgcccttc
tcttcctccatcagaccctgtatgctggcaacctgtgcaaggcctggaaggccttccacc
aagcacagtcctcacatcgcagctgcacgaaacatatacatccagacccgcaggcagagg
aagctgcacttcgttgtgggaggatttgcttacctgcttcccaagactaccgtggtgctc
cggtgtcccacacgcagattccgcaagcccctcatcacgtgggaaaaggacggccagcac
agcatcagctcggctcatgtcaccgtagccccttttggctacctgaagatccatcgcctc
aagccctcagatgcgggcatctacacctgttctgcggggcccgcccgggagcagtttgtg
attaagctcattggaggcaaccgcaagctcgtggccaggcccctgagcctttggagtgag
gaagaggaggccctgcaggtgaggaagaccaatccaaaagaagccttgcaaacccacaaa
caccaaaatggcatcttctccaacggcagcaaagctgagaagcgcggcctcactgcagat
cctgggaaccgctatgatgacattgtgtctaggctgttggagcagggcggctggccagga
gagctcctggcctcgtgggaggtgcaggactctgcagaaaggaacgcatcctcagaagag
gatcccaatgctgaacaggccctcctgcatctccccttcaccatggtggccgagcagaag
cgtctggatgacatcctcaggaacctgtcccagcagccagaggagctacgggacctctac
agcaagcacctggtggcccagctggcccaggacatcttccgaagccacctggagaaccag
gatctgcttcctaagccctctgagcagaggtttcctcccatggccgtcccagctcacaaa
catgtctctggcttcagcagctccctaaggagctcatctggagaggctggaggtggctcc
cgtaggcctcatcgcaagcccgccatcttgcggaagatctcagcggcacagcaactctca
gcctcggaggtagtcacccacctggggcagactgtggctctagccagtgggaccctgagt
gtgcttctgcactgtgaggcggtaggcaacccaaggcccaccatccactggaccaggaac
ggagaagcagttcaattcagtgacaggattcttctacagccagatgattccttacagatc
ttggcaccagtggaagctgatgtgggtttctatacttgcaatgccacaaatgccttggga
tatgactctgtctccattgctgtcacattagcaggaaagccactagtgaagacatcccga
atgactgtgctcaacacagagaagcctacagtcacagtggatatcggtggcaccgtcaga
accgtccgaggagtgaatgtgacaattaactgccaagtggcaggtgtacctgaagctgaa
gtcacctggttcagaaataaaagcaaattgggctcctcccaccacctgcatgagggctcc
tcccaccacctgcatgagggctccttgctgctcacagatgtgtccttctctgatcaaggc
ctgtattcctgcagggcagccaatctacacggagaacagacagagagcacgcagctcctg
attctagatcccccgcaagtccccacacagttggaagacatcagggccttgctcttagcc
actggaccgaaccttccttcggtgcttatgtcccctctgggaacacagctggtcctggat
cctgggaattccgctctccttggctgccccatcaaaggtcaccccacccccaatatcacc
tggttccaaaatggccagccaattgccactgccccggggctgacccaccacatctgggga
gctggacagatcctacgagttgcaaatctcagtggaggacctcaaggggagttcagctgc
ctggctcagaatgaagcagggaccctcctgcagaaagcctctttggtgatccaagattac
tggtggtctgtggatagactggcaacctgctccgcatcttgtggtaatagaggcattcat
cagccgcgactcaggtgtttactgaacaccacggaagttgaccctgagcactgtacagga
aagcctcggcccgccgtgcagcctgttgcctgcaaccggagagactgtccttctcgatgg
atggtgacgtcctggtccgcctgtacccggagttgcggtggaggtgtacaaacccgaagg
gtgacctgtcagaagttgaaagcttctggtatttctaccccggtgtccaatgacatgtgc
agtcaactggccaaacggcctgtggacacccaggcctgcaaccagcagctctgtgtggaa
tgggccttctccagctggggccagtgcaatgggccttgcataggccctcgccttgctgtg
cagcacaggcaggtcttctgccagacccgggatggcatcaccttaccatcagagcagtgc
agtgccctccccaggcccgtgagcacccaaaactgctggtcagaggcctgcagtgtacac
tggagagtcagcctctggaccctatgcacggcaacctgtggcaactatggcttccagtcc
cggcgggtggagtgtgttcacgtgcgcaccaacaaggctgtgcccgagcacctgtgttcc
tgggggccccggcccgccaactggcaacgctgcaacgtcactccatgtgaaaacactgag
tgcagagacaccaccaggtactgcgagaaggtgagacagttgaaactctgccagctcggc
cagttccgatctcgctgctgtggaacgtgtggcaaagcatga

DBGET integrated database retrieval system