KEGG   Mus musculus (house mouse): 77763
Entry
77763             CDS       T01002                                 
Symbol
Gm9736
Name
(RefSeq) predicted gene 9736
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Keratin_B2_2
Other DBs
NCBI-GeneID: 77763
NCBI-ProteinID: NP_001357737
MGI: 3842085
Ensembl: ENSMUSG00000112380
Position
10:complement(77586205..77587257)
AA seq 277 aa
MATSTMSVCSDACTNSSWQVDDCPESCCEPCCCAPSCCQSSCCQPSCCVPSCCAPAPCLT
LVCTPVSCVSSPCCQFSCCTPSCCQQSSCQPACCTCSPCQQPCCVTLCCKPVCCVPVCCG
ASSSCCQQSSCESSCCTSSPCQQPCCEPICCEPLCCEPVCCTPICPGPCCQQSSCQSSCC
QSPCCVPVCCKPVCCTPICSGSSSCCQPSCCAPVCCKPCSSVSLLCRPVCRPACCVPTSS
CCASSCQPSCCCPTSSVSLLCRPACSRQACCGQKSSC
NT seq 834 nt   +upstreamnt  +downstreamnt
atggccacctccaccatgtctgtctgctctgacgcttgcaccaactcctcctggcaggtg
gatgactgcccagagagctgctgtgagccctgctgctgtgcccccagctgctgccagtct
agctgctgccagcccagctgctgtgtccccagctgctgtgccccagccccctgcctgacc
cttgtctgcaccccagtgagctgtgtgtccagcccctgctgccaattttcctgctgcaca
ccgtcatgctgccagcagtctagctgccagccagcttgctgtacctgctccccttgccaa
cagccctgctgtgtgaccctttgctgcaaacctgtctgctgtgtgccagtctgctgtggc
gcttcctcctcatgctgccagcagtctagctgtgagtcctcttgctgcacctcttctccc
tgccagcagccctgctgtgaacctatctgttgtgagcctttgtgttgtgaacctgtctgt
tgtacacccatctgccctggaccatgctgccagcagtctagctgccagtcctcatgctgt
caatccccctgctgtgtgcctgtctgctgcaagcctgtttgctgcacacccatctgctct
ggctcctcctcctgctgccagccctcctgctgtgctccagtctgctgcaagccctgctcc
agtgtgtccctgctgtgccgcccagtgtgcagacctgcctgctgtgtgcccacctcctcc
tgctgtgcctcctcctgccaacccagctgctgctgtccaacctccagtgtgtccctgctg
tgccgccctgcctgctccagacaggcctgctgtggacagaagtccagctgctga

DBGET integrated database retrieval system