KEGG   Mus musculus (mouse): 77767Help
Entry
77767             CDS       T01002                                 

Gene name
Ermn, A330104H05Rik, AI854460, ermin, mKIAA1189
Definition
(RefSeq) ermin, ERM-like protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: ERM
Motif
Other DBs
NCBI-GeneID: 77767
NCBI-ProteinID: NP_084248
MGI: 1925017
Ensembl: ENSMUSG00000026830
Vega: OTTMUSG00000012597
UniProt: Q5EBJ4
Position
2 C1.1; 2
AA seq 281 aa AA seqDB search
MTDTPETLSGTECNGDRPPENGQQPSSQTRQETTDADETQAYYKVEPSLEDLPAKENQEE
TGNTKGNILPKGPEDEKILNENPEENLFVVHQAIKDLSLQEISAEDMAFREGHPWKKIPP
NSSNLEVSRQKERTAQQQLEQRGDASTTEIEWLGFQKSRPVDILHSKCDEEEEEEEEVWN
EEINEEDVDECAEEEDEVRVIEFKRKHREGSPLKEESLAREDSPLGSPGSQPGTPDEQPV
FGKKGDIARNSYSRYNTISYRKIRKGNTKQRIDEFESMMHL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacagatactcctgagacactgagcgggacagagtgcaatggggacagaccacctgag
aatggccaacagcctagcagtcaaaccaggcaggagacaactgatgcagatgagacccag
gcatactacaaggttgaacccagtcttgaagatttacctgcaaaagaaaatcaagaagaa
actggaaacactaaagggaacatacttcctaaagggcctgaagatgagaagatcctcaat
gaaaacccagaagagaacctcttcgttgttcaccaggccatcaaagatctttctctccaa
gaaataagtgcagaagacatggctttccgagaagggcatccgtggaagaagattcctccg
aacagcagtaacctggaagtgagtagacagaaggaaagaactgcccagcaacagcttgag
cagagaggagatgcgagtacaactgaaatcgaatggctggggttccagaaatctcgtcca
gttgacatcttgcattctaagtgtgacgaggaagaagaagaagaagaagaagtttggaat
gaagagataaatgaggaagatgttgatgagtgtgctgaagaggaagatgaagttcgagta
atagaatttaagagaaaacacagagaaggttctccattaaaagaggaaagccttgcaagg
gaggactccccactaggcagccctggctcccaacctgggaccccagatgagcagccagtg
ttcggaaagaagggagatatcgccaggaattcttattccagatacaacacgatatcctat
cggaaaataaggaaaggcaacaccaaacagagaattgatgagtttgagtcaatgatgcac
ttataa

DBGET integrated database retrieval system