KEGG   Mus musculus (house mouse): 77767
Entry
77767             CDS       T01002                                 
Symbol
Ermn, A330104H05Rik, AI854460, ermin, mKIAA1189
Name
(RefSeq) ermin, ERM-like protein
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Ermin ERM_C
Other DBs
NCBI-GeneID: 77767
NCBI-ProteinID: NP_084248
MGI: 1925017
Ensembl: ENSMUSG00000026830
UniProt: Q5EBJ4
Position
2:complement(57874920..57942962)
AA seq 281 aa
MTDTPETLSGTECNGDRPPENGQQPSSQTRQETTDADETQAYYKVEPSLEDLPAKENQEE
TGNTKGNILPKGPEDEKILNENPEENLFVVHQAIKDLSLQEISAEDMAFREGHPWKKIPP
NSSNLEVSRQKERTAQQQLEQRGDASTTEIEWLGFQKSRPVDILHSKCDEEEEEEEEVWN
EEINEEDVDECAEEEDEVRVIEFKRKHREGSPLKEESLAREDSPLGSPGSQPGTPDEQPV
FGKKGDIARNSYSRYNTISYRKIRKGNTKQRIDEFESMMHL
NT seq 846 nt   +upstreamnt  +downstreamnt
atgacagatactcctgagacactgagcgggacagagtgcaatggggacagaccacctgag
aatggccaacagcctagcagtcaaaccaggcaggagacaactgatgcagatgagacccag
gcatactacaaggttgaacccagtcttgaagatttacctgcaaaagaaaatcaagaagaa
actggaaacactaaagggaacatacttcctaaagggcctgaagatgagaagatcctcaat
gaaaacccagaagagaacctcttcgttgttcaccaggccatcaaagatctttctctccaa
gaaataagtgcagaagacatggctttccgagaagggcatccgtggaagaagattcctccg
aacagcagtaacctggaagtgagtagacagaaggaaagaactgcccagcaacagcttgag
cagagaggagatgcgagtacaactgaaatcgaatggctggggttccagaaatctcgtcca
gttgacatcttgcattctaagtgtgacgaggaagaagaagaagaagaagaagtttggaat
gaagagataaatgaggaagatgttgatgagtgtgctgaagaggaagatgaagttcgagta
atagaatttaagagaaaacacagagaaggttctccattaaaagaggaaagccttgcaagg
gaggactccccactaggcagccctggctcccaacctgggaccccagatgagcagccagtg
ttcggaaagaagggagatatcgccaggaattcttattccagatacaacacgatatcctat
cggaaaataaggaaaggcaacaccaaacagagaattgatgagtttgagtcaatgatgcac
ttataa

DBGET integrated database retrieval system