KEGG   Mus musculus (mouse): 77777
Entry
77777             CDS       T01002                                 

Gene name
Ulbp1, A430108B07Rik, MULT, MULT1
Definition
(RefSeq) UL16 binding protein 1
  KO
K07986  UL16 binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    77777 (Ulbp1)
SSDB
Motif
Pfam: MHC_I
Other DBs
NCBI-GeneID: 77777
NCBI-ProteinID: NP_084251
MGI: 1925027
Ensembl: ENSMUSG00000079685
UniProt: Q8HWA3
Position
10; 10 A1
AA seq 334 aa
MELTASNKVLSCCLSLLCLLSVCLCPRIEETASLCNIYKVNRSESGQHSHEVQGLLNRQP
LFVYKDKKCHAIGAHRNSMNATKICEKEVDTLKDGIDIFKGLLLHIVQETNTTGKPLTLQ
AEVCGQYEVDKHFTGYAIVSLNGKNIFRVDTSTGNWTQLDHEFEKFIEMCKEDKVLAAFL
KKTTEGDCRTWLDELMLHWKEHLEPAGSFSTLMIILCVIAIAFLGLIFGVSCKLRHLRTK
KIGLQSSPPPLLDDSLTVPTSPQSSVCGTMIQCLCPRKLKSPVFMQIDLQSSAPPLLDDS
LTVPETCSVKKEDEFPTASQNSVLLTSDDIDGIP
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggagctgactgccagtaacaaggtcctttcctgctgcttgtccctgctgtgcctgctg
tctgtctgtctgtgtccaaggatagaagagactgcttctctttgtaacatttacaaggtt
aacaggtcagagtctggacaacatagtcatgaagttcaaggcctactcaacagacagcct
ctttttgtctacaaggataaaaagtgtcatgccattggtgctcataggaacagcatgaat
gctacaaagatctgtgaaaaagaggttgacactctgaaagatggaattgacattttcaaa
ggtctgctgcttcacatagtgcaggagactaacacaaccggaaagcccctcactctgcag
gctgaggtgtgtggccagtatgaagtagacaaacatttcacaggatacgccattgttagc
ctcaatggaaagaatatattccgtgttgacacaagcactggcaactggacccaactggat
catgaattcgagaagtttatagaaatgtgcaaggaagacaaggttttagctgccttttta
aagaagactacagagggcgactgcaggacctggcttgatgagctcatgttgcactggaaa
gaacatctggagcctgcaggatctttcagtaccttgatgattattctatgcgtgattgca
attgcctttctcggattgatcttcggagtctcttgtaaattaagacatttacgtacaaaa
aagattggcctgcagtcctcaccaccacctctcttggatgactctttgacagtgcctact
tcaccacaatccagtgtatgtggaactatgattcaatgtctctgtcctcggaagttgaag
tcacctgtgtttatgcagattgatctgcagtcctcagcaccacctctgttggatgactct
ttgacagtgcctgagacgtgttcagtaaagaaagaagatgaatttccgacagcatctcag
aattctgtgctgttgacttcagacgatattgatgggatcccatga

DBGET integrated database retrieval system