KEGG   Mus musculus (mouse): 77832Help
Entry
77832             CDS       T01002                                 

Gene name
Tchp, A930031F18Rik, AV279199
Definition
(RefSeq) trichoplein, keratin filament binding
  KO
K16811  trichoplein keratin filament-binding protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    77832 (Tchp)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    77832 (Tchp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPH
Motif
Other DBs
NCBI-GeneID: 77832
NCBI-ProteinID: NP_084268
MGI: 1925082
Ensembl: ENSMUSG00000002486
Vega: OTTMUSG00000014526
UniProt: Q3TVW5
Position
5; 5 F
AA seq 497 aa AA seqDB search
MALPTLPSYWSSRKHMDLRQRQHQQEDQFRQQWEQNSRYFRTWDIHNSKQIEWSSKISYQ
RSMHAYHCEKMKEEKRKILELRRERLRELLLEEQDLLAAELDELRLSMGLREQRLREQHQ
DLKSAREEQRKLIAERLLYEHWKKNNPKLRELELDLHKKHVINSWATQKEEKKQQEATEK
QENKRLENQYAAARREAEARMRVEEERRQLEGRLQAEALRQQMEELKQKEMEATKLKKEQ
ENLLRQRWELERLEEERRQMAALRRKTELGRFLKHQYNAQLNRRTQEIQEELEVDGRILQ
ALLEKEGELQQVELARREQARADAAWMKQVIEEQLQLEKAREAELQQLLREEAKEMWEKR
EAEWAREQVARDRLMSEVLTGRQQQILEKIEQNRRAQEETLKHREKLIRSLEEGKQLAQR
AKEESEELKLARKQELEAQVAERQGQEWEAARQEEEEEEEARQAEEHSNALLQQEAKTMA
EKGYQPKLHGHLRIAWD
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggctctccccacgttgccctcttattggtccagccggaaacacatggatcttcgccag
cgccagcatcagcaggaggaccagtttcgccagcagtgggaacagaacagtcgctatttc
aggacctgggacatccacaactcgaaacagatcgaatggagctccaagatctcctaccag
cggagcatgcacgcctaccattgtgagaagatgaaggaggagaagaggaagattctggag
ctccggcgggagaggctcagagagcttctcctggaggaacaggacttgctggctgcggag
ctggatgagctcaggctgagcatgggcctgcgggagcaaaggctccgcgagcagcaccag
gacctgaagtcagcccgagaagaacagaggaagctgattgctgaacgacttttatatgaa
cactggaagaagaacaaccccaaacttcgagagcttgagttggaccttcacaagaagcac
gtgataaattcttgggcaacacagaaagaagaaaaaaaacagcaagaagccacagagaag
caggagaacaagcggttggagaaccagtacgcagcagcccgccgggaagccgaggcgagg
atgagagtcgaggaggagaggaggcagctagaggggcgcctgcaggccgaggcgctgcgc
cagcagatggaggagctgaagcagaaggagatggaggcaaccaaactgaagaaggaacag
gagaacctgctgaggcagcgctgggagctggaaaggctggaggaggaaaggaggcagatg
gccgccctccggcgcaagacagagctggggcgcttcttgaaacatcagtacaacgcgcag
ctcaacaggcgcacccaggagatccaggaggagctggaggtagatgggcggatcctgcag
gccctcctggagaaggaaggcgagttgcagcaggtggaactggccaggcgggagcaagcc
cgggccgatgcggcctggatgaagcaggtcatcgaggagcaactgcagctggagaaagca
cgggaggcagagctgcagcagctgctgagggaggaggccaaggagatgtgggagaagaga
gaggccgagtgggcccgagagcaggtcgcgcgggacagactgatgagtgaggttctgacc
gggaggcagcagcagatcctggagaagattgaacagaaccggcgggcacaggaggagacc
ctcaaacacagggagaaactcatcaggagtctcgaggaggggaagcagttagctcagcga
gccaaggaggagagtgaagagctgaagttggccaggaagcaggagctggaagcccaggtt
gcagagcgccagggccaggaatgggaagcagcccggcaggaggaggaggaagaggaggag
gccaggcaggcggaagagcactccaatgctttgctgcagcaggaggcgaagaccatggca
gagaagggctatcagcccaagcttcacggacacctcagaattgcttgggactga

DBGET integrated database retrieval system