KEGG   Mus musculus (mouse): 77862Help
Entry
77862             CDS       T01002                                 

Gene name
Thyn1, D730042P09Rik, HSPC144, MDS012, MY105, Thy28
Definition
(RefSeq) thymocyte nuclear protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: EVE
Motif
Other DBs
NCBI-GeneID: 77862
NCBI-ProteinID: NP_653126
MGI: 1925112
Ensembl: ENSMUSG00000035443
Vega: OTTMUSG00000062681
UniProt: Q91YJ3
Position
9; 9 A4
AA seq 226 aa AA seqDB search
MPRPRKRQTGTAGPDRKKLSGKRTKTENSESTSVKLENSSLEMTTTFKNGGKNLSNYWLM
KSEPESRLEKGIDMKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEDEAFFYHSNCK
QPGIVGLMKIVKEAYPDHTQFEKSNPHYDPSSKEDDPKWSMVDVQFVRMMKRFIPLEELK
TYHQAHKATGGPLKSMTLFTRQRLSVQPLTQEEFDFILSLEETEPS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgccgagaccccgcaagaggcagactgggactgctggtccagacaggaagaagctatcc
gggaaacgtactaaaactgaaaactcagaaagtacatcagtcaagctagagaactccagc
cttgagatgacgacaacctttaaaaatggtggcaagaatttaagcaactactggctgatg
aagtcagagccagaaagccggctagagaaaggtatagacatgaagttcagcatcgaggat
ctcaaagcacagcccaagcagacagcttgctgggatggtgttcgcaactatcaggctcgg
aacttcctcagggccatgaaattggaggatgaagccttcttctaccatagcaactgcaaa
cagcctggcattgttggacttatgaagattgtaaaggaggcttacccagaccacacacag
tttgagaaaagtaatccccattacgatccatccagcaaagaggacgaccctaaatggtcg
atggtggatgtacagtttgttcgaatgatgaagcgcttcatccctctggaggagcttaaa
acctatcaccaagcccacaaagctactggcggccccttaaaaagcatgactctcttcacc
cgccagagactttccgttcagcctctgactcaagaagagtttgattttattttgagcctg
gaggaaacagaaccaagttaa

DBGET integrated database retrieval system