KEGG   Mus musculus (mouse): 77877Help
Entry
77877             CDS       T01002                                 

Gene name
6030458C11Rik
Definition
(RefSeq) RIKEN cDNA 6030458C11 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0489
Motif
Other DBs
NCBI-GeneID: 77877
NCBI-ProteinID: NP_084274
MGI: 1925127
Ensembl: ENSMUSG00000022195
UniProt: Q8BGC1
Position
15; 15 A1
AA seq 442 aa AA seqDB search
MSDTGGDRARLRRYTKLPVWVVEDHQEVLPFIYRAIGSKHLPDSNISFLHLDSHPDLLIP
VNMPADTVFDKEALFGELSIENWIMPAVYAGHFSQVIWLHPTWAQQIREGKHCFLVGKDI
STTTIRVTSTDSYFLSDGLFVPEDQLENRRPLQLDVILVEPYTLCSKQDDSDSVSSTKKP
KLALGSGESSAAADGHSCSEGRRGDAVTPRSDHACQEPSCSRSGGQQSQNTATAGAILDI
LKTGDAFVLDIDLDFFSVKNPFKEMFTQDEYKILQELYQFKKPDSNLPEDGLVDVVEART
HQLEDLEAVFADLCDGDSEETVQSWASNPGMESLVPLVQSLKKRMEVPDYEMVHQAGLTC
DYSELPHHISTEEEIEYLIQSVYFLLKSLPKPTLVTIARSSLDDYCPPEQVDMIQGKVLD
VLHSLYGTLDTHLVYSEESPLS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaccggaggcgaccgcgcgcgactcaggcgctacaccaagctcccggtgtgg
gtggtggaggatcaccaggaggttctgcctttcatataccgggccataggttcgaagcat
cttcctgacagtaatataagtttcttacatttggactcccacccagacctccttatccct
gtgaacatgccagcagacactgtgtttgataaggaagcactctttggagaactgagtatc
gaaaattggattatgcctgcagtttacgctggccatttttctcaagtaatctggctccac
cccacgtgggcccagcaaatcagggagggcaagcactgcttcttagtaggcaaagacatt
tctaccacaaccatcagggttacaagtacagattcttacttcctaagtgatggtctgttt
gtacctgaagaccagctagagaaccgaaggcccttacagttagatgtgattctggtagaa
ccttacacactctgtagcaaacaagatgacagtgactctgtgtcttctacaaagaagccc
aagctggcactgggaagtggagagagcagcgctgcggctgatgggcactcttgctcagaa
ggacgtcgaggagacgcagtgacaccaagaagtgaccatgcttgccaggagccgtcctgc
tcacgttccggaggtcagcagagccagaacacagccaccgctggggcgattctggacata
ctgaagacgggagatgcgtttgttttagatattgacttggattttttttctgtcaaaaac
cccttcaaagaaatgttcactcaggatgaatacaaaattctacaggagctttaccagttt
aaaaagcctgatagtaaccttcctgaggatggtttggtggatgttgttgaggctcgaacc
catcagttggaagatttagaagcagtctttgctgacttgtgtgacggtgatagtgaagaa
accgtacagagctgggcttcaaaccctgggatggagtcactagttccacttgtacagagt
ttgaaaaaacggatggaagtaccagactatgaaatggtccaccaggctgggctaacttgc
gattattcagaacttcctcatcatatcagcacagaagaagaaattgagtatcttattcag
tctgtgtattttctattaaaaagtctaccaaaacctactcttgtgacaattgcaaggtca
agtctggatgattactgtcctccggaacaagttgacatgattcagggaaaggtcctcgat
gtgctgcactcactctacgggaccctggacactcacctggtgtactcagaagagtcccct
ctgagctga

DBGET integrated database retrieval system