KEGG   Mus musculus (mouse): 77987Help
Entry
77987             CDS       T01002                                 

Gene name
Ascc3, ASC1p200, B630009I04Rik, BC023451, D430001L07Rik, D630041L21, Helic1, RNAH
Definition
(RefSeq) activating signal cointegrator 1 complex subunit 3
  KO
K18663  activating signal cointegrator complex subunit 3 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    77987 (Ascc3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     77987 (Ascc3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   Direct repair
    77987 (Ascc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec63 DEAD ResIII Helicase_C AAA_22 Helicase_PWI T2SSE PhoH AAA_19 IstB_IS21
Motif
Other DBs
NCBI-GeneID: 77987
NCBI-ProteinID: NP_932124
MGI: 1925237
Ensembl: ENSMUSG00000038774
UniProt: E9PZJ8
Position
10; 10 B3
AA seq 2198 aa AA seqDB search
MALPRLTGALRSFSNVTKQDNYNEEVADLKLKRSKLHEQVLDFGLTWKKIVKFLNEKLEK
NKMQNINEDLKDILQAAKQIVGTDNGREAIESGAAFLFMTFHMTDSVGYMETKAIRQTFG
PFPSSSATSACNATNRIISHFSQDDLTAFVQMAENPCNDRVVFGKNLAFSFDMYDLDHFD
ELPINGESQKTISLDYKKFLNEQFQEPYTPELKPVEKTNGSLLWCEVEKYLNATLKEMTE
AARVEDLCCTLYDMLASAKSGDELQDELFELLGPEGLDLIEKLLQNRITIVDRFLNSSSD
HKFQVLQDSCKKILGENSKPNYGCQVTIQSEQEKQLMKQYRREEKRIARREKKAGEDGEV
SGEGVLPFDPKELRIQREHALLNARNAPILGRQRDVEFEKIRYPHVYDSQAQARETSAFI
AGAKMILPEGIQRENTKLYEEVRIPYGEPMPVGFEEKPVYIKDLDEVGQLAFKGMKRLNR
IQSIVFETAYNTNENMLICAPTGAGKTNIAMLTILHEIRQHFHQGVIKKNEFKIVYVAPM
KALAAEMTNYFSKRLEPLGIVVKELTGDMQLSKSEILRTQMLVTTPEKWDVVTRKSVGDV
ALSQIVKLLILDEVHLLHEDRGPVLESIVARTLRQVESTQSMIRILGLSATLPNYLDVAT
FLHVNPYIGLFYFDGRFRPVPLGQTFLGIKSTNKMQQLNNMDEVCYESVLKQVKAGHQVM
VFVHARNATVRTAMSLIERAKNSGQISCFLPTEGPEYGHALKQVQKSRNKQVRELFSDGF
SIHHAGMLRQDRNLVENLFSNGHIKVLVCTATLAWGVNLPAHAVVIKGTQIYAAKRGSFV
DLGILDVMQIFGRAGRPQFDKFGEGIIITTHDKLSHYLSLLTQQNPIESQFLESLADNLN
AEIALGTVTNVEEAVRWMSYTYLYVRMRANPLAYGISHKAYQIDPTLRKHREQLLIEVGQ
KLDKAKMIRFEERTGYFSSTDLGRTASHFYIKYNTIETFNELFDAHKTEGDIFAIVSKAE
EFDQIKVREEEIEELDALLNNFCELSAPGGVENSYGKINILLQTYISRGEMDSFSLISDS
AYVAQNAARIVRALFEIALRKRWPTMTYRLLNLSKVIDKRLWGWASPLRQFSVLPPHILT
RLEEKNLTVDKLKDMRKDEIGHILHHVNIGLKVKQCVHQIPSVTMEASIQPITRTVLRVS
LNIHPDFSWNDQVHGTVGEPWWIWVEDPTNDHIYHSEYFLALKKQVINKEAQLLVFTIPI
FEPLPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPITALGCKAYE
ALYNFSHFNPVQTQIFHTLYHTDCNVLLGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIA
PLKALVRERMDDWKIRIEEKLGKKVIELTGDVTPDMKSIAKADLIVTTPEKWDGVSRSWQ
NRSYVQQVNILIIDEIHLLGEERGPVLEVIVSRTNFISSHTEKPVRIVGLSTALANARDL
ADWLNIKQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMASMNKPAFQAIRSHSPAKPVL
IFVSSRRQTRLTALELIAFLATEEDPKQWLNMDEQEMDNIIGTVRDSNLKLTLAFGIGMH
HAGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVIIKGTEYYDGKTRRYVDFP
ITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLGVLSDHLNAEI
AGGTITSKQDAMDYITWTYFFRRLIMNPSYYSLGDVSQDSINKFLSHLIGQSLVELELSH
CIEVGEDNRTIEPLTCGRIASYYYLKHKTVKMFKDRLKPECSTEELLSILSDAEEYTDLP
VRHNEDHTNNELAKCLPIELNPHSFDSPHTKAHLLLQAHLSRAMLPCPDYDTDTKTVLDQ
ALRVCQAMLDVAASQGWLVTVLNITHLIQMVIQGRWLKDSSLLTIPNIEQHHLHLFRKWK
PPVKSSHAKCRTSIECLPELIHACEGKDHVFSSMVEKELQPAKTKQAWNFLSRLPVINVG
ISVKGSWDDLVEGHNELSISTLTADKRDENKWIKLHADQEYVLQVSLQRVHFGLPKGKHE
NHAVTPRFPKLKDEGWFLILGEVDKRELMAVKRVGFVRTHHDASISFFTPETPGRYIFTL
YLMSDCYLGLDQQYDIYLNVIKANISTKDSDVFTDLSV
NT seq 6597 nt NT seq  +upstreamnt  +downstreamnt
atggctctacctcggctcacaggagccttgcgctccttttcaaatgtcaccaagcaagat
aattacaatgaagaagtagctgacttgaagttgaagcgatctaaacttcatgaacaagtt
ttagattttggccttacatggaagaagatagtgaaatttttgaatgaaaagctagagaag
aataaaatgcaaaatataaatgaagacttaaaagacatactacaagctgcaaaacaaatc
gttggaacggataatgggagagaagcaattgagagtggggctgcatttctctttatgaca
tttcacatgacggactctgttggttacatggagacaaaggctatcagacagacgtttggt
ccctttccatcgtcatctgctacttcagcttgtaatgccactaatcgaattatttctcat
tttagtcaagatgatctcactgcttttgtccagatggcagaaaacccatgtaacgataga
gtggtttttggcaaaaacttagcattttcttttgacatgtatgatctggaccactttgat
gaattaccaataaatggtgaatcccagaaaactataagcttagactacaagaagttcctg
aatgaacagttccaggaaccctacactcctgagctcaagcctgtggagaaaacaaatggc
tccctattgtggtgtgaagttgagaagtacttaaacgcaacgttaaaggaaatgactgaa
gcagcaagagttgaagatctttgctgtactctatatgacatgcttgcttctgctaaaagc
ggcgatgaacttcaggacgagctgtttgaattgctgggacctgaaggactggatctgatt
gagaagctgctccagaacagaattacaattgtagatcggttccttaattcctcgagcgat
cataagtttcaagttctccaagatagttgtaaaaagattttaggagagaattcaaagcct
aattatggatgtcaagtcactattcaatctgaacaagaaaaacagttaatgaaacaatat
cgacgtgaagaaaaaagaattgccaggcgagaaaaaaaggctggagaagatggggaagtt
tctggagaaggagttttgccctttgatcctaaggaactccggatacagagagaacatgca
cttctgaatgctagaaatgctccaattttaggaagacagagagacgtggagtttgaaaaa
atccgttatcctcatgtttatgattcccaggctcaggcccgagaaacatcagcattcata
gctggagccaagatgattttaccagaaggaatccagagagagaataccaagctgtatgag
gaagtcaggatcccctatggtgaaccaatgccagttgggtttgaggaaaaaccagtttat
atcaaagatttagatgaggttggacagttggcttttaaaggaatgaagagactcaataga
atccagtctatagtatttgaaacagcctacaacaccaacgaaaacatgctgatctgtgcc
cctacgggagctgggaagaccaatattgcaatgcttactatcttacatgaaatccgccaa
cactttcatcaaggtgttattaaaaagaatgagtttaagattgtgtatgtcgctccaatg
aaagccttggcagctgagatgacaaattacttcagcaaacgtctagagccactgggcatt
gttgtgaaagaattgactggagatatgcagttgtcaaaaagtgaaattttacgaactcag
atgctggtgaccacaccagaaaaatgggatgtagtaacaagaaagagtgttggggatgtt
gctctttcccaaatcgtaaaactcctgattcttgacgaggtgcacttgctgcatgaagac
agaggcccagtgctagaaagcatagtcgccaggaccttacggcaggttgaatccacacag
agtatgataagaattcttggattgtctgcaaccttacccaactacctcgatgttgctaca
tttttgcatgttaacccctacattggacttttctactttgatggccgttttcgacctgta
cctcttggacagacatttttagggattaaaagtacaaacaagatgcagcagttaaataac
atggatgaagtgtgctacgaaagtgttctgaaacaagtaaaggctggacaccaggtgatg
gtatttgtacatgctcgcaatgccactgtaaggaccgctatgtctctaatagagagagca
aaaaatagtggccaaatttcttgctttctacccaccgaagggccagagtacggacatgca
ttaaaacaggtacaaaagtcaagaaataagcaagtgcgagaattattctccgatggcttt
agcattcatcatgccgggatgcttcggcaagacagaaatttggttgaaaatttgttttca
aatgggcatatcaaagtcctagtctgtacagccacattagcctggggtgtcaatcttcct
gcacatgccgtggttattaagggaacacaaatatacgctgccaaaagaggctcctttgtt
gaccttggaattttagatgtcatgcagatatttggccgagctggacgaccgcaatttgac
aaatttggggaaggaatcattataacaacccacgataaactcagccattacctcagtttg
ctcactcaacaaaacccaattgagagtcagtttctggaaagtcttgcagataacctaaat
gcagagattgcgctggggacagtcaccaacgtggaagaggcagtgaggtggatgagttac
acttacctctatgtgcgcatgcgagcaaacccgctagcatacggcatcagtcacaaagcg
taccagattgacccaacactaaggaagcatcgagaacagctccttattgaagttggacaa
aagttggataaagcaaagatgattcgttttgaagaacgaactggctatttttcttctact
gatttgggtagaactgccagccacttctatattaaatacaacaccattgagacatttaat
gaactctttgatgcacacaaaacagagggtgatatctttgctattgtttccaaagctgaa
gaatttgatcaaattaaggtcagagaagaagaaatagaagaattagatgccttgttaaac
aatttctgtgaactctcagctccaggaggtgtggaaaatagttatgggaaaataaatatc
ctacttcaaacctacatcagccgaggagagatggacagtttctccctcatatcagattct
gcatatgtcgcccagaatgcagctagaattgtccgtgctctctttgaaattgcactgagg
aaacgttggcctaccatgacctacaggcttttgaatcttagtaaagtcattgacaagaga
ctctggggttgggctagccctttgagacaattttctgtgttaccaccacacattctaaca
agattagaagaaaaaaaccttactgtggataaactcaaagacatgagaaaagatgaaata
ggtcacattttgcatcatgtgaatattggactgaaggtcaaacagtgtgttcatcaaatt
ccttctgttacaatggaagcttccattcagcccatcacacggactgtcctccgagtatca
ctgaacatccaccctgatttctcttggaatgaccaggttcatggaacagtgggggaacca
tggtggatttgggtagaagatcctacaaatgaccatatttatcactcggagtactttcta
gctcttaaaaaacaggttattaataaggaagctcaacttctggtatttacaattcctatt
tttgagcctttgccctctcagtactacattcgagcagtgtctgatcgatggctaggagct
gaagctgtttgcattatcaactttcaacatctgattctaccagagagacatcctccccat
acagaattattggaccttcaacctttaccaattacagctttggggtgcaaagcatatgaa
gctctatataacttcagccactttaaccctgtacagacgcagatattccacacactgtat
cacacagactgtaatgttctgcttggcgcccccaccggatcaggaaagacagttgcagct
gaactagccattttcagagttttcaacaaatatcctacttcaaaggcagtatatattgca
cccctcaaagctctagtacgtgaaagaatggatgattggaaaattaggatagaagaaaaa
cttggtaaaaaagttattgaactaactggggatgtgactccagacatgaaatccattgct
aaggctgaccttattgtcaccacaccagaaaagtgggatggagttagtcgaagctggcag
aatagaagctatgttcagcaggtcaacattctcatcatagatgagatccatctgctaggg
gaggagagaggcccagttttagaagtcattgtatctcgaacaaactttatctcatcacac
acagaaaaaccagttagaatagttggactgtccactgcattagctaatgctagagatctt
gctgactggctcaacattaagcagatgggtttgtttaacttccgaccatcagttcgccca
gttccactggaagttcacattcagggtttcccaggacaacattactgcccacgcatggct
agtatgaacaagcctgcatttcaggcaattagaagtcactctccagccaagcctgttttg
atatttgtctcatcaagacgtcaaacacgacttacagccttagagttgatagcatttctg
gccactgaagaagacccaaagcagtggttgaatatggatgagcaagagatggacaacatc
attggaacagtacgagattccaacctcaagctgactctagcttttggaataggaatgcat
catgctggcctgcatgaaagagaccgaaaaactgtagaagagctgtttgtgaactgtaaa
gttcaggttctcattgctacaagcacattagcatggggtgtaaactttccagcacactta
gtaattattaagggaactgaatattatgatggaaagacaagacgttatgtggattttccc
atcacagatgtgctgcagatgatgggacgagctgggagacctcagtttgatgaccagggc
aaagctgtaattctagttcatgatataaaaaaagatttttataaaaagtttctttatgaa
cctttcccagtagaatcaagcttattaggagtgttgtctgaccacttaaatgcagagatt
gctggaggtacaataacatcaaagcaagatgcaatggattatatcacctggacttacttt
ttccggcgtcttatcatgaatcccagctactacagcttgggtgacgtcagccaggactcc
ataaacaagttcctgtcacatctgattgggcagtctctggttgaattggagctttcccac
tgcattgaagttggagaggataatcgcaccattgaaccactgacatgtggtcgaattgcc
tcctattactatttgaagcacaaaactgtcaaaatgttcaaggaccgtttgaaacctgag
tgcagcactgaggaactgctgtcaattctgagtgatgcagaagaatacacagacttacca
gtaagacacaatgaggaccatacgaataatgaattggccaaatgtcttcccattgaatta
aatcctcattcatttgacagccctcacaccaaagcccatctcttgcttcaagcgcatctc
agccgagccatgctgccctgcccagattatgatactgataccaaaacagtcttagaccaa
gctctcagagtatgccaggcaatgctggatgtggctgcaagccagggatggctagtgacc
gtcctgaatatcacccacctgattcagatggtgatccaaggccgatggctcaaggactct
tctcttctcacaataccaaacatagagcagcaccaccttcaccttttcaggaaatggaag
ccacctgtaaagagctcacatgctaagtgccgaacatccattgagtgccttcctgagctg
atccatgcctgtgaagggaaggaccatgtgttcagctccatggtagagaaagagttacag
cctgcaaaaacaaagcaggcatggaatttcttatctcgcttgccagtgataaatgttggc
ataagtgttaaaggctcatgggatgacttagttgaaggacataatgaactctccatctca
actctgacagcagacaaacgggatgaaaacaaatggatcaagttgcatgctgatcaggag
tatgtgcttcaagtcagcctacagagagtccattttgggcttccaaagggaaaacatgag
aatcacgcagttactcctcgatttccaaaattaaaagatgaaggctggtttttgatatta
ggagaagtggataagagagagctgatggctgtaaaacgagtaggatttgttcgaacacat
catgatgcttccatctcgttctttactcctgaaacacctggaagatatatctttaccctg
tatctcatgagtgactgttacctcggcctagaccagcagtatgacatttatctcaatgtc
ataaaagcaaacatttctacaaaggactctgatgtcttcactgacttgtcagtatag

DBGET integrated database retrieval system