KEGG   Mus musculus (house mouse): 78088
Entry
78088             CDS       T01002                                 
Symbol
Sowahb, 5730467H21Rik, Ankrd56
Name
(RefSeq) sosondowah ankyrin repeat domain family member B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Ank Ank_2 Ank_4 Ank_3 Ank_5
Other DBs
NCBI-GeneID: 78088
NCBI-ProteinID: NP_780479
MGI: 1925338
Ensembl: ENSMUSG00000045314
UniProt: Q8BZW2
Position
5:complement(93188981..93192910)
AA seq 760 aa
MAGELSQEALLDFLCQAGGRVRNAELLSHFKSFLRDPHVSPGQLQERRERFKGFVNSVAA
VRQDPDGTKYVVLKRRYRDLLGEEGLQRPGPVDGKPRGHRRRDPEPQKPPAGAGTQVDVG
GSAQKVAGPDPSPEDSPNQRTPEPEAAQARGRCAAVGTRGRCCWECQQNGWGQSTGQPLP
EDLGDPAVACEKPERAAPARDDLGAPGWLREGEAAEHAPGSVPPVWPPTAVEAAGSPTSP
PALPPHPAPSREPLELFTAGSPNHSTQQLQQQHQRTQEWVARYLQVPEPEIQAPTRAWSV
LPDNFLQLPSETAFGVSETSSALPEPALSFHSLLPVVLDESSESWPGNAPSTVFRSIRCQ
LSLQDLNDFVEQESHGSEESSSGPKESPGTPEEGLQPVLRTSSWGELRDPVEDLFLPPND
SPCLIRRDLGYRGNAPSFRKVPTVAKSLGDHPQEPFPALKFRRSVRRSSRTGRTKSPSSS
DEEHPDEDLWKRSRRPPRSRKPSKAGALPSPRVDAVLVQKLADANAVASQPHSSWIPSRD
GSAALIPHRPSEHRSPLVPLDTREHEWIVRLASGSWLHVLTLFWEDPQLALHRDFLTGYT
ALHWIAKHGDLCALQDLVSGAQKAGIALDVNVRSSCGYTPLHLAAIHGHQGVIKLLVQRL
ASRVNIRDCSGKKPWQYLNSNVSGETWQLLGAPRGKPIFPVYSLVQSSSPARKVKSREVS
RNVTRKTSLAALLKTQHNKWKLASQYEKIHTSKEREEYSD
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggccggagagctgagccaggaggcactgctggactttctgtgccaggccgggggccga
gtgcgtaacgcagagctgctgagccacttcaagagcttcctgcgcgaccctcacgtgtct
ccaggccagctgcaggagcgtcgcgagcgcttcaagggcttcgtgaactcggtggccgca
gtgcgccaggaccccgacggcaccaagtacgtggtgctcaagaggaggtacagggaccta
ctgggggaggagggcctgcagcgaccgggccctgtagatggaaagccgcggggccaccgc
cgccgtgacccggagccgcagaagccgccggcaggtgcggggacccaggtggacgtaggt
ggcagcgcgcagaaggtggccgggccagaccccagcccggaggacagcccgaaccagagg
acaccggagccagaggctgctcaagccagaggcaggtgtgcggctgtggggacgcgagga
cgctgctgctgggagtgccagcagaacggctggggacagtccaccggacagccgctgcca
gaagatctcggagaccctgcagtcgcctgcgagaagccggagcgcgctgcacctgcccgg
gatgacctcggagctccggggtggctgagggaaggagaggccgccgagcacgcgcctgga
tctgtaccgcctgtctggcctccgaccgccgtcgaggctgctggcagcccgacgtccccg
cctgctctcccgccccacccggcgccctccagagagccactggagctgtttaccgccggc
tccccgaaccattcaacccagcagctgcagcaacagcaccagcgcactcaagagtgggta
gccagatacctgcaggtgcctgagcccgagatccaggcgcccactcgcgcctggtcggtg
ttgccagacaacttcctccagctaccttcagaaaccgcctttggggtctcggagaccagc
tcggcgctgccagagcccgctctgtcttttcattctctccttcccgtggttctcgatgag
tcctcagaatcctggccagggaacgctccatctaccgtctttcgaagcattcgttgtcag
ctgtccctccaggatctgaatgactttgtggagcaagagagccatggaagtgaggagagc
agcagtggacccaaagaatctcccggaacccccgaagaggggctgcaacctgtcttgaga
acttcctcctggggggagctcagggatccagttgaggatctgtttttgccaccaaacgac
agcccttgcctgatccggcgggacctcggatatagagggaatgcgcccagttttcggaag
gtcccaacagtggctaaaagccttggagaccacccccaagagcccttccctgccctcaag
ttccgaaggtctgtcaggaggagctctcgaacaggaagaaccaaatctccttcttcctca
gacgaggagcatcctgatgaggacttgtggaaaaggagtcggcgcccacctcggtccagg
aaaccttccaaggcaggagccctgcccagcccaagggtggatgctgttttggtacagaaa
ttggcagatgctaatgctgtggccagtcagccacactcttcatggatcccaagcagggat
ggatctgcagccttgataccccacagaccttctgagcacaggtccccccttgtccctcta
gacaccagggagcatgagtggattgtgaggcttgccagtggttcctggcttcacgtgctg
actttgttctgggaggacccccagctggctttgcacagagacttcctgactgggtacaca
gccttgcactggatagcaaagcatggtgacctgtgtgcccttcaggatttggtctctgga
gcccagaaggcgggcattgcactagatgtaaatgtgaggtccagttgtggctatacccca
ctgcaccttgcagctattcacgggcaccagggagtcatcaaattgctagtgcaaagactg
gcttctcgggtgaacattcgggactgcagtggcaagaagccatggcagtatctgaacagt
aacgtctctggggaaacgtggcagctcctgggtgcaccccggggcaaacctatcttccct
gtctattccttagtccaaagctcttccccagccaggaaggtcaagagccgggaagtgtct
agaaatgtcacccggaagacttccttggctgctttgctcaaaactcagcacaacaaatgg
aaattggccagccaatatgagaaaatccacacctcaaaggagagagaagagtatagtgac
tga

DBGET integrated database retrieval system