KEGG   Mus musculus (mouse): 78100
Entry
78100             CDS       T01002                                 

Symbol
Msantd4, 8430410K20Rik, Mysantd4
Name
(RefSeq) Myb/SANT-like DNA-binding domain containing 4 with coiled-coils
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Myb_DNA-bind_5 Myb_DNA-binding
Other DBs
NCBI-GeneID: 78100
NCBI-ProteinID: NP_663584
MGI: 1925350
Ensembl: ENSMUSG00000041124
Vega: OTTMUSG00000061685
UniProt: Q91YU3
Position
9; 9 A1
AA seq 345 aa
MKQLKRKRKSNFSVQETQTLLKEITKRKEVIFSKQLNTTINVMKRMAWEEIAQCVNAVGE
GEQRTGTEVKRRYLDWRALMKRKRMKANMKLVGSGFPLPTSDLDDSLTEDIDEKIAFRND
ANFEWQNVADFRDAGGSLTEVKVEEEERDPQSPEFEIEEEEEMLSSVIPDSRRENELPDF
PHIDEFFTLNSTPSRPTYDEPHLLMNIEKQKLELEKRRLDIEAERLQVEKERLQIEKERL
RHLDLEHERLQLEKERLQIEREKWRLQLVSTEKPALENELGQGEKSMLQPQDIEAEKLKL
ERERLQLEKDRLQFLKFESEKLQIEKERLQVEKERLRIQKEGHLP
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgaagcaattgaaaagaaaaaggaaaagcaattttagtgttcaggagactcagaccctt
ttaaaagaaattaccaagaggaaggaagtcattttttccaagcagctcaacacaacaata
aacgtgatgaagcgaatggcctgggaggagatcgcacagtgtgtgaatgctgtcggagaa
ggagagcagaggacaggcacagaggttaagagacgttacctggactggcgcgcactcatg
aaaaggaagaggatgaaggccaacatgaagctcgttggttctgggtttcctctgcccacg
tctgatctagatgactctctcactgaagacatagatgaaaaaattgccttccgaaatgat
gcaaattttgagtggcagaatgtggcagatttccgggatgcaggtggatccttaacagag
gtcaaagtggaagaggaagaaagggatcctcagagcccagaatttgagattgaggaggag
gaagagatgctgtcatctgtcataccagattccaggagggaaaacgagctccctgacttc
cctcacattgatgagtttttcaccctcaattccacaccatccagacccacctatgatgag
ccccatctgctcatgaacatagagaaacagaagctggagctggaaaaacgccgacttgat
attgaggcggaaaggctgcaggtggaaaaggagcggctgcagatagagaaagagcgcctg
cgccacctggacctggagcacgagcgcttacagctggagaaggagaggctgcagatcgag
agagaaaagtggaggctgcagctggtcagcaccgagaaaccggctctagagaacgagctg
ggccagggcgagaagtccatgctgcagccacaggacatcgaagcagagaagctgaaactt
gagcgcgaacgtctacagctggaaaaagatcggctgcaatttttgaagtttgaatcagag
aagctgcagatagaaaaggagcgcttgcaggtggagaaggagagactgcggattcagaaa
gaagggcatttgccttga

DBGET integrated database retrieval system