KEGG   Mus musculus (mouse): 78240Help
Entry
78240             CDS       T01002                                 

Gene name
Cst11, 9230101F08Rik, BB067629, CRES2, mCSTE1
Definition
(RefSeq) cystatin 11
  KO
K13906  cystatin-11
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    78240 (Cst11)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I25: cystatin family
   78240 (Cst11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin SQAPI Cathelicidins
Motif
Other DBs
NCBI-GeneID: 78240
NCBI-ProteinID: NP_084335
MGI: 1925490
Ensembl: ENSMUSG00000036958
Vega: OTTMUSG00000015725
UniProt: Q9D269
Position
2; 2 G3
AA seq 139 aa AA seqDB search
MAAGSWKATRLLLAILVALVAFSYQVKRKTFIRIEEVSALESSVKETLEYVTDEYNKKSE
DLYNFRILRILKIMKQVTGHLEYHITVEMQRTTCLKTETSLCDIQKGELHKKIQCYFSVY
AIPWVEVFKILKKNCTDIS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggatcttggaaggcaacacggctcctgttggccattctggtggccctggtg
gctttcagctaccaagtaaagaggaaaacatttatacggattgaagaagtgagtgcattg
gagtcttctgtgaaggagacattggagtatgtcacagatgaatacaacaagaaaagtgaa
gacttgtacaacttcaggatccttcgaatcctgaagattatgaagcaggtgacaggtcac
ctggagtatcacatcacagtggaaatgcagcggaccacctgcttgaagacagagacgagc
ctctgtgatatccagaaaggggaacttcacaagaaaatccagtgctacttctcagtgtac
gccattccctgggttgaagtattcaaaatactcaagaaaaactgtaccgatatcagctga

DBGET integrated database retrieval system