KEGG   Mus musculus (mouse): 78244Help
Entry
78244             CDS       T01002                                 

Gene name
Dnajc21, 4930461P20Rik, 9930116P15Rik
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C21
  KO
K09506  DnaJ homolog subfamily A member 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    78244 (Dnajc21)
   03110 Chaperones and folding catalysts [BR:mmu03110]
    78244 (Dnajc21)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    78244 (Dnajc21)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   78244 (Dnajc21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ zf-C2H2_jaz zf-C2H2_2 zf-met zf-C2H2_4 zf-C2H2_6 zf-C2H2
Motif
Other DBs
NCBI-GeneID: 78244
NCBI-ProteinID: NP_084322
MGI: 1925371
Ensembl: ENSMUSG00000044224
Vega: OTTMUSG00000033460
UniProt: E9Q8D0
Position
15; 15 A1
AA seq 531 aa AA seqDB search
MKCHYEALGVRRDASEEELKKAYRKLALRWHPDKNLDNAAEAAEQFKLIQAAYDVLSDPQ
ERAWYDNHREALLKGGLDGEYQDDSLDLLHYFTVTCYSGYGDDERGFYAVYRVVFELIAK
EELECMSEGDVEDFPTFGDSQSDYDTVVHPFYAHWQSFCTQKNFSWKEEYDTRQASNRWE
KRAMEKENKKIRDRARKEKNELVRQLVAFIRKRDKRVQAHRKLVEEQNAEKARKAEEMRR
QQKLKQAKLAEQYREQSWMTMANLEKELQEMEARYEKEFGDGSDENEVEDQEPRNGLDGK
DSEEAEEAELYQDLYCPACDKSFKTEKAMKNHEKSKKHREMVALLKQQLEEEEEQFSGVQ
MDENVLNANSEEEMEDTPKQKLSKKQKKKKQKSAQNFDDNFNENGTEEGGKIAPEKTKSN
EDNAKELENRPQENTCITETTEACEDPKSEAKSVPKSKGKKTKDVKKSVKAPAEAQPVSD
VLISCATCHSEFPSRNKLFDHLKATGHARAPSATASLNSVTRNKKEKRRSR
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtcactacgaggcgctgggggtgcggcgcgacgccagcgaggaggagctcaag
aaggcctatcggaagctggccctgaggtggcacccggataaaaatctggacaatgccgca
gaagcagctgagcagtttaaattaatccaagctgcatatgacgtcttaagtgaccctcag
gaaagagcgtggtacgataaccaccgagaggccttacttaaaggagggctcgatggggaa
tatcaagatgacagcttagatctgcttcattatttcacggttacctgttattctggttat
ggggacgatgaaagggggttctatgcagtgtatcgtgttgtctttgagctgattgcaaaa
gaagaactggagtgtatgtcagagggagatgttgaggattttccaaccttcggcgactcc
cagagcgactatgacacggtggtccaccctttctacgctcactggcagagtttctgcaca
caaaagaatttttcctggaaggaagagtatgatacccggcaagcctcgaaccgctgggaa
aaacgagccatggaaaaagaaaacaaaaaaattcgagacagagcaaggaaagagaaaaat
gaactggtgcgccagctggtagccttcattcgtaaacgagataagagagtgcaggcccat
cggaagcttgtggaggagcagaacgcagagaaggcgaggaaggcagaggagatgaggagg
cagcagaagctgaagcaagccaagctggcagagcagtacagagagcagagctggatgacc
atggccaatttggagaaggagctccaggagatggaagcaaggtacgagaaggagtttgga
gatggatcagatgaaaacgaagtggaggatcaggagcccagaaacggattggatggcaag
gacagcgaggaggctgaggaggctgagctttaccaggacctttactgcccagcttgtgac
aaatccttcaagacagaaaaggccatgaagaatcacgagaagtcaaagaaacatcgggaa
atggttgccttgttaaaacagcagttggaggaggaggaagaacagttttcaggagttcaa
atggatgaaaatgtattgaatgccaattctgaggaggaaatggaagatacaccaaagcag
aagctttctaaaaaacagaagaaaaagaaacagaaatcagcacagaattttgatgacaat
ttcaatgaaaatggaactgaagaaggaggaaagattgctccagaaaagactaagtcaaat
gaagacaatgccaaagaattagaaaataggccccaagaaaatacctgtattacagagacc
acagaagcctgtgaggatccaaaaagcgaagctaaaagtgttcctaaatccaaaggaaag
aaaaccaaagatgtgaaaaaatctgtcaaagcacctgctgaagcacagccagtgagtgat
gtcctcatcagctgtgcgacttgccacagtgaatttccatcccggaataaactgtttgat
catctaaaggctactggtcatgcaagagcaccttcagccacagcatctttaaacagtgta
actaggaacaagaaagagaagcgtagaagtagatag

DBGET integrated database retrieval system