KEGG   Mus musculus (house mouse): 78248
Entry
78248             CDS       T01002                                 
Symbol
Armcx1, 3010033I09Rik, ALEX1
Name
(RefSeq) armadillo repeat containing, X-linked 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Arm_2 Atx10homo_assoc
Other DBs
NCBI-GeneID: 78248
NCBI-ProteinID: NP_001159849
MGI: 1925498
Ensembl: ENSMUSG00000033460
Vega: OTTMUSG00000019429
UniProt: Q9CX83
Position
X:133618615..133623487
AA seq 456 aa
MGRTREAGCVAAGMVIGAGACYCVYRLTWGKDENEKLWDEEEEEEEEEEEKSCSDKTEKE
LKTNVGVGARGKPQDDSKSKVEVNVGPENGPGVKKEVHPESQSGGGLEAKAKALFKTLKE
QARAKAGRGIRLPNISRNRTLTSSLPCPGGRGGGCHPGRTGSRARNRTSGKVKRKNRSKS
NKAPATAWPVRKGKFSFPYKIDDILSAPDLQKVLNILERTNDPFTQEVALVTLGNNAAYS
FNQNAIRELGGVPIIAKLIKTRDPIIREKTYNALNNLSVNSENQGKIKTYISQVCDDTMV
CRLDSAVQMAGLRLLTNMTVTNHYQHLLSYSFPDFFALLFLGNHFTKIQTMKLIINFTEN
PAMTRELVSCKVPSELISLFNKEWDREILLNILTLFENINDNIKSEGLASSRKEFSRSSL
FFLFKESGVCVKKIKALASHKDLVVKVKVLKVLTKL
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgggtcgcacccgggaagctggatgtgtggctgcaggcatggtcattggggctggtgcc
tgctactgtgtatacagactgacctggggaaaagatgagaatgagaagttgtgggatgag
gaagaggaggaagaggaggaagaggaggaaaagtcttgtagtgacaaaactgagaaagaa
cttaagactaatgttggggtaggggcgagaggcaaacctcaagatgactcaaagtccaag
gttgaggtgaatgtgggacctgagaatggtccaggtgtaaagaaagaagtgcacccagaa
tcccagagtgggggtggactagaggctaaggccaaggcccttttcaagactctaaaggaa
caggcacgtgcaaaggcaggcagaggcataaggcttcctaacatctctaggaataggacc
ctgacatcaagtttgccttgcccaggaggcaggggtggaggctgccacccgggaaggact
ggttctagggctaggaacaggacaagtgggaaagtcaagagaaagaaccgaagcaagagc
aacaaggctccagccacagcatggcctgtacgcaagggcaagttcagctttccctataaa
attgatgatattctgagcgcccctgatcttcaaaaggtcctgaacatcctggagagaaca
aatgacccttttactcaggaagtagcactggtcacactgggtaacaatgcagcatattca
tttaatcaaaacgccatccgtgagctgggtggagtccccattattgcaaagctgataaaa
acaagagaccccattattagggaaaagacttacaatgctcttaataacttgagcgttaat
tctgagaatcagggcaagattaagacttatatcagtcaagtgtgtgacgataccatggtt
tgccgcttggactcagccgtccagatggctggattaagactccttaccaacatgactgta
actaatcactaccaacatttgctttcctattctttcccagatttctttgctttgttattc
ctgggaaaccacttcaccaagatacagactatgaaactgattataaattttactgaaaac
ccagccatgacaagagagctggtcagttgtaaagtaccttcggaattgatttctctgttt
aataaagaatgggatagagagattcttcttaacattcttaccctctttgaaaatataaac
gataacataaaaagtgaagggcttgcatcctccaggaaggaattcagcaggagctcactg
tttttcttatttaaagagtctggagtatgtgtgaagaaaatcaaagcattagcaagccat
aaggatctggtggtcaaagtgaaagttctaaaagtcttaacaaaattataa

DBGET integrated database retrieval system