KEGG   Mus musculus (house mouse): 78250
Entry
78250             CDS       T01002                                 
Symbol
Iqch, 4921504K03Rik
Name
(RefSeq) IQ motif containing H
  KO
K24842  IQ domain-containing protein H
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    78250 (Iqch)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  IQ domain-containing proteins
   78250 (Iqch)
SSDB
Motif
Pfam: IQ
Other DBs
NCBI-GeneID: 78250
NCBI-ProteinID: NP_001298027
MGI: 1925500
Ensembl: ENSMUSG00000037801
UniProt: Q9D2K4
Position
9:complement(63328522..63509808)
AA seq 1071 aa
MAQAQEDSDPIGSILIQVHEDLHQLKEKLVKFSAEETRSTLDIQNLETAIQRTEMGLKIH
IDKYLGVVNQEVLMAPVKKSLESPVTSKWSIPTVIDQKSFIFPMDSDFWRPQKHRGSLLH
GLRRAKPKIQLTTKVMQDPENKHHRAAVTASYGISLPHINQRKAQDKVQRLIKGSTISNL
TVLPPSHRTDPHFIPIPVLQKDASKGVLSMIERGLIPPTARITFQNPPIKPQALPLHSFD
EHRKVPMEASFPLALKPRPVPEEVEEPSHQIEIPKGRAKRSRGPLRRKGMKIRTPSKTRK
SPWDYIFSVYNGCVDRTAPDFLAFKSRFKLIWGSIFSFLEQIEKFLKDYAISEAKIKGKS
LVSLLPEFELKNKLTRNDVLAVLENPVHIQMLLNLPGQRYKGQDGKAEAATKIQATWKSY
KARSSFISYRQKKWASGVIALAWLLHCHRTRLKRIVKESRQRHLENFRIRAQHLAANWSR
IRTSRRTIIHIPSLGYSQYVRKHIFDLDVEQNMQLGRLCDIIDANVNVIYICSHPMTDEL
KLYYRKLLSLQAAVKTGYYGDRTDLQNRFRIITPEAVNVFTKHHMCLATHLMYSPKAIKR
IKNLIRGEEAYIVGGILHRDDLAVADMLNVPILGSEPELVHLYSAKSGSKRIFDNANVPM
PPGIYDIYTYQQMIEQLSQLVTDNLGIRRWVFKMNTEFGGNGTAFCDIPSHLQCYNWVLK
ERNRFGHEDWKKKWAQESALVKISEELAGILAQHVQLVNEKRFPTWRKFLHMFLTQGGVI
EAYPPADSVTNLTVDMLIEPDGEVRVLSMGDQLHADGPFISSGTTMPQTSVDPQVLNSLC
LQIGNICKEKDVVGYFSIDLVTFIDPSTLEQQVWTTGLNLSYSDQLAMTQLTLYLTNGHL
NCSLSTLEVPRFTEDSERERKRLSIQAELAPETSRYAVMSTQLKHDNLSLIFYYVFLQMC
KAHGIGYDLEDRQGTVFILYESLKRYKLGMLTIGVDLQGVLMTFARNLFIIHQEISAPDM
QGETNFKTTIDDIETILGVTEENKMIFVREKQSKEEEDNLYEPVEIHSEIV
NT seq 3216 nt   +upstreamnt  +downstreamnt
atggcgcaggcccaggaggacagcgaccccattggatccatcctaatccaggttcatgag
gaccttcatcagttaaaggaaaaattagtaaaattctcagccgaggagacaaggagcact
ctagacattcaaaatcttgagacagcaatccaaaggactgaaatggggttaaagattcac
atcgacaagtatctaggtgttgtaaaccaggaggtgttaatggctcctgtgaagaaaagc
ttggaatcccctgtcacttccaaatggtcgattccaactgtaattgaccagaaatccttt
attttccccatggattctgatttttggcgacctcaaaagcatcgcggttcattgctacac
ggccttagaagagcaaagccaaagatacagttgactacgaaggtcatgcaggaccctgag
aacaagcaccacagggctgctgtaactgctagctatgggatcagtttgccacatattaac
cagaggaaagcccaggataaggttcagcggttaataaaagggtccacgatctccaacctc
acagttctgccaccctctcatcgcactgacccccattttatccccatacctgtcttgcag
aaggatgccagtaaaggcgtcttaagtatgattgagcgagggctgatccccccaacagcg
aggattacctttcagaacccacccattaaaccccaagcacttcctctgcacagttttgat
gagcatcgtaaggtacccatggaagcctcctttcctctcgctctcaagccacgcccagtt
cctgaagaagtggaggagccttctcaccagatagaaatacccaaggggagagccaaaagg
tcaagaggaccgctcagaagaaagggcatgaagattaggacaccgtctaagactaggaaa
tcaccatgggattatatattttctgtttacaacggctgtgtagacaggacagccccagac
ttcttagcattcaaatcacgcttcaaattaatctgggggagtattttttctttcctggaa
caaattgagaaatttctcaaggactatgcaatatctgaagccaaaataaaagggaagagt
ctggtgtccctgcttccagagtttgagctgaagaacaaattaaccagaaatgatgttctg
gctgtgttagagaacccagttcacattcagatgctgttaaaccttccgggacagaggtac
aagggccaagatggaaaggcagaagctgccaccaagatccaagccacgtggaaaagttac
aaggcaagatcttctttcatttcttatcgccagaagaaatgggcctcaggtgtgatcgcc
ctggcgtggcttttacattgccacaggacaagactaaagaggatagtgaaggaatcccga
cagagacacctggagaacttccgcattcgagcccagcatctggcagccaactggagtcgc
atcaggacctccaggaggactattatccatataccatcattagggtactcccagtatgtg
agaaaacacatttttgatttggacgtagaacagaacatgcagttggggaggctgtgcgac
atcatagatgccaacgtcaatgtcatctacatctgttcccatcctatgacggatgagtta
aagctgtactacaggaaactcctgagtctacaagcagctgtcaaaacggggtactacggg
gatcggactgacctgcagaacaggttcagaattatcacccctgaagctgtaaacgtcttc
actaagcatcacatgtgcctggccactcacctgatgtacagtcccaaggcaatcaaaaga
ataaaaaatctcatccgaggagaagaggcctacatcgtgggcgggatcctccacagagac
gacttagctgtggccgatatgctgaatgtccccatcctgggctcagagcctgagctggtt
cacctgtacagtgccaagtctggaagcaagcggatctttgataatgctaatgtgccaatg
cctcctggaatatatgacatctatacttaccaacagatgatagaacagttgagccagttg
gtgactgataacctgggaatccgacgctgggtctttaaaatgaacacggaatttggagga
aatgggacagcattttgtgacattccttcccatctacagtgctacaactgggtgctgaag
gaaagaaacagatttggccatgaggactggaagaagaagtgggcacaagagtcagctctg
gtgaagatctccgaggagctggcgggcattttagcacagcacgtacagctagtcaatgag
aaacggttcccgacgtggaggaaattcctccacatgtttctcactcaaggtggcgtgatt
gaagcatacccacctgcagacagcgtcaccaacctcacagtagacatgctgatagaacct
gatggagaagtcagggtgctgtcaatgggagaccagcttcatgctgatggcccctttatt
tcttctggtaccaccatgcctcagacctcagtggatccccaagttctcaattctttgtgc
ctccaaattggaaatatctgcaaagagaaagatgtggttggttatttttctatagatctg
gtgactttcattgatccgagcaccttagagcagcaggtatggacaacaggcctcaacctc
tcatacagtgaccagctagccatgacgcagctcaccctctacctgacaaatggtcatctg
aattgtagtctgagcaccctggaagtgccccgttttactgaagattcagaaagggaaagg
aagcgccttagcatccaggcagagctggcaccagaaaccagtcgctatgcagtgatgtcc
acccagctgaagcatgacaatctctcactaatcttctattacgtttttctccagatgtgt
aaggcccatggcattggctatgaccttgaggacagacaaggaactgtttttatattatat
gaatctctgaagagatacaagttgggcatgttaacaatcggtgtggatctccagggggtc
ctcatgacctttgctcgcaatctcttcatcatccatcaagaaatatcagcacctgatatg
caaggcgagaccaattttaagactaccattgatgatattgaaaccattttaggagtaaca
gaagaaaataaaatgatatttgtaagagaaaaacagagcaaagaggaggaagataacctt
tatgaacctgttgaaatacactcagaaatagtctga

DBGET integrated database retrieval system