KEGG   Mus musculus (house mouse): 78255
Entry
78255             CDS       T01002                                 
Symbol
Ralgps2, 1810020P17Rik, 2210408F11Rik, 4921528G01Rik, 9130014M22Rik
Name
(RefSeq) Ral GEF with PH domain and SH3 binding motif 2
  KO
K24023  Ras-specific guanine nucleotide-releasing factor RalGPS
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    78255 (Ralgps2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   78255 (Ralgps2)
SSDB
Motif
Pfam: RasGEF PH CRISPR_Cas9_WED Med16_bridge
Other DBs
NCBI-GeneID: 78255
NCBI-ProteinID: NP_001153437
MGI: 1925505
Ensembl: ENSMUSG00000026594
UniProt: Q9ERD6
Position
1:complement(156631736..156767422)
AA seq 590 aa
MDLMNGQASSVTIAATVSEKSSSSESLSEKGSELKKSFDAVVFDVLKVTPEEYAGQITLM
DVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEV
LSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKE
DNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIIS
DLQQSCEYDIPILPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGASTPRSAASREDL
AGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMN
TAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWPA
FERNRLYHSLGPVTRVPRNGYRSHTKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKEG
KKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVVGWMVMMADDPEHP
DLFLLTDSEKGNSYKFQAGSRMNAMLWFKHLSAACQSNKQQVPTNLMTFE
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggacctaatgaacgggcaggcaagcagtgttactatcgcagccactgtttccgagaag
agtagcagctctgagtcactaagcgagaagggctctgaattgaagaaaagctttgatgct
gtggtgtttgatgttcttaaggttacgccagaagaatacgcgggtcagataacactaatg
gatgttccagtgtttaaagctattcagccagatgaactttcaagttgtggatggaataaa
aaagaaaaatatagttctgcaccaaatgcagttgctttcacaagaagatttaatcacgta
agcttttgggttgtaagagagattctccatgctcaaacactgaaaataagagcagaagtt
ttgagccactatattaagactgctaagaaactatatgaacttaacaaccttcacgcactt
atggctgtggtttctggcttacagagtgcgccgattttccggttgactaagacgtgggcg
ttattaagtcgaaaagacaaaactacctttgaaaaactagaatatgtaatgagtaaagaa
gataactacaaaagactcagagactatataagcagcttaaagatgactccttgcattccc
tatttaggcatctatttgtctgacttgacctacattgactccgcgtacccatccaccggc
agcattctagaaaatgagcaaagatcaaatctgatgaacaacattcttcgaataatttct
gatttgcagcagtcctgtgaatatgatattcccatattgcctcatgtccaaaaatacctg
aactctgttcagtatatagaagaactacaaaagtttgtggaagacgataattacaagctc
tccttaaagatagaaccaggagcaagtactccacgctcggctgcctccagggaggaccta
gcaggtcctgacataggcgcctcaccccagggagggaggaagagtagtgctgctgctgct
gccgccgcggctgccgagggagccttactgccacagacgccaccttcccctcggaacctc
attccacacggacacaggaagtgccacagcctgggttacaatttcattcataagatgaac
acagcagagtttaagagcgcaacgttcccaaacgcagggccacggcacctgctggatgat
agtgtcatggagccgcacgcaccgtcgcgaggccaggctgagagctctacactttccagt
ggaatatccatagggagcagtgatggttctgaactaagcgaagagacctcatggccggct
tttgaaaggaacagattataccattctctcggcccggtgacaagagtgccgcgaaatggc
tatcgaagccacacgaaggccagcagctctgcggagtcggaagatttggcggtgcatctg
taccccggagctgttactattcaaggtgtgctccggaggaaaaccttgctaaaagaaggc
aagaaacccacagtagcatcttggacaaagtattgggcagccttgtgtggaacacagctt
ttttactatgccgccaaatctctgaaggctacagaaagaaagcatttcaaatcaacgtca
aataagaatgtgtctgtggtgggctggatggtgatgatggctgacgacccagagcatcca
gacctctttctgctgactgactccgagaaaggaaattcatacaagtttcaagctggcagc
aggatgaatgcaatgctgtggtttaaacacttgagcgcggcctgccagagtaacaagcaa
caggttcctacaaacttgatgacttttgagtaa

DBGET integrated database retrieval system