KEGG   Mus musculus (house mouse): 78267
Entry
78267             CDS       T01002                                 
Symbol
Klhdc8b, 4931406O17Rik
Name
(RefSeq) kelch domain containing 8B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 Kelch_3 Kelch_4 Kelch_2 Kelch_5 DUF1668
Other DBs
NCBI-GeneID: 78267
NCBI-ProteinID: NP_084351
MGI: 1925517
Ensembl: ENSMUSG00000032609
UniProt: Q9D2D9
Position
9:complement(108324834..108338780)
AA seq 354 aa
MAAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAETLDMGSHTWL
ALAPLPTARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLADEGRWERRATLPQAAMGV
ATVERDGMVYALGGMGPDTAPQAQVLVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIYVL
GGRQGKLPVTAFEAFDLETRTWTRHPSLPSRRAFAGCAMAEGSVFSLGGLQQPGPHNFYS
RPHFVNTVEMFDLEHGSWTKLPRSLRMRDKRADFVVGSLGGNIVAIGGLGNQPCPLASVE
SFSLARRRWEVLPAMPTARCSCSSLQAGPRLFVIGGVAQGPSQAVEALCLRDGV
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggctgcaggaggtggtcgggcctttgcttggcaggtgttccccccaatgccgacttgc
cgggtatatggtacagtggcacaccaggacggacacctgctggtgttggggggctgtggc
cgggctgggttacctctggatactgctgagactctggacatgggctcacacacatggcta
gcactagcacccctgcccactgcccgggctggtgccgctgctgtggttctgggtaagcag
gtgctagtggtaggcggcgtggacgaagtccaaagcccagtagctgctgtggaggccttc
ttggctgacgaaggccgctgggagcgccgggctaccctccctcaagcggccatgggtgtt
gcgactgtggagagagatggtatggtgtatgctctggggggaatgggtcctgacacggcc
ccccaggcccaggtactggtatatgagccccgccgggactgctggctttcgctaccctcc
atgcccacaccctgctatggggcctccaccttcctgcacgggaacaagatctatgtcttg
ggaggccgccagggcaagctcccagtgactgcttttgaagcttttgatctggagacccgt
acatggacccgacacccaagcctgcccagtcgcagagcttttgctggctgtgctatggcc
gaaggcagtgtctttagcctgggtggcctgcagcagcctgggccccacaatttctactcc
cggccgcactttgtcaacactgtggagatgtttgacctggagcatggctcctggactaag
ctgcctcgtagcctgcggatgagggataagagggctgactttgtggttggctcccttggg
ggcaacattgtggctattgggggccttgggaaccagccatgccctttggcctccgtggag
agcttcagtcttgcacggagacgctgggaggtgctgcctgccatgcctacggcccgatgc
tcctgctccagcctccaggctgggccacgactgtttgttattgggggtgtggctcagggc
ccaagtcaagcggtggaagcactgtgtctacgggatggagtctga

DBGET integrated database retrieval system