KEGG   Mus musculus (mouse): 78283
Entry
78283             CDS       T01002                                 

Symbol
Map7d2, 1600028E09Rik, 2900002G04Rik, 5330432J06Rik, C030036K04Rik, Mtap7d2
Name
(RefSeq) MAP7 domain containing 2
  KO
K24203  MAP7 domain-containing protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    78283 (Map7d2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     78283 (Map7d2)
SSDB
Motif
Pfam: MAP7
Other DBs
NCBI-GeneID: 78283
NCBI-ProteinID: NP_001074593
MGI: 1917474
Ensembl: ENSMUSG00000041020
Vega: OTTMUSG00000019440
UniProt: A2AG50
Position
X:158197488..158281954
AA seq 781 aa
MERSGGNGGGGGGGGGGGGGYGGSGGGGGGAGVPSEGAAKGLSLLLAKSAEAASGRASQS
TPRSAGMDGFLKSDERQRLAKERREEREKCLAAREQQILEKQKRAKLQYEKQIEERWRKL
EEQRQREDQKRAAVEEKRKQKLREEEERLEAMMRRSLERTQQLELKKKCSWAGSPGPGGR
DGESENTPPLPLTLATSTPPLDTGTTTAAAESTNACDKLSTSTMNLPKQTESPMSKHLSS
STVAISYSPDRALGSPLKSSYKSSPTRTTEKKKNTPISAMGDAGKGAMAGGEPSQMEKMK
KGRVATSAASGGHGSPLRRCEPPEDISKRLSSPVKSKITSKTYPQSPKTAKPTYLGSPVK
YYFPPIANEETPKKKAEKEKRNKEKEGAPGQQSTVLPREESLEKRMADKYATEKYVADKH
ATEKHSAPGGKAEHSAGKPTAGTTDAGEAAKILAEKRRQARLQKEQEEQERLEKEERERL
EKEELKRKAEEERLRIEMAYKREQEKKRQEEEEKRKAEEKAKEKAEEELLSKEKQEKEKQ
EQEKKEKAMIEKQKEAAEAKAQDAAKQMRLEREQIMLQIEQERLERKKRIDEIMKRTRKS
DASLEVKKEDPKVELQPPPDVENKANKAKPVVPNKIEINVLNTCQKVSGSERAAPETFPQ
DIFSTGLKPVGGPVHLDVLDGKSNSLDDSTEDVQSMDVSPVSKEELISIPEFSPVSEMIP
GMSLDQNGTGNARALQDILDFTGPPAFPKKSSENLSLDDCNKNLIEGFNSPGQETTLNTF
C
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggagcgcagcggtgggaacggcggcggcggcggtggcggcggcggcggcggcggcggg
tacggcggcagcggtggcggtggcggaggagccggagtcccctcggaaggggctgccaag
ggcttgtcgctgctgctggccaagtccgcggaagcggcctccgggagagcctcccagtcc
accccgcggtccgcaggaatggatggatttttaaaatcagatgagagacaaagattagcc
aaagagagacgagaagaaagagaaaaatgtctggctgctcgggaacaacagatcttagag
aaacagaagagagccaagcttcagtatgagaaacaaattgaggagcgatggagaaaactt
gaggagcagcgccaacgggaggatcagaagagggcagcagtggaagagaagaggaagcag
aagctccgggaagaagaggagcgcctggaagcaatgatgcgccggtccctggagcgtaca
caacagctagagctgaagaagaagtgctcatgggcaggatcaccagggcctggcggacgt
gatggtgaatcagaaaataccccaccccttcctctaactttagcaaccagcaccccccct
ttggacacagggaccactacagctgctgccgagtccaccaacgcatgtgacaaactttca
acatcaaccatgaatttgccaaagcagacggagtctcctatgagtaaacacctgtcttca
tccaccgtggcaatatcttattccccagaccgagctctcgggagccctctcaaatcttca
tacaagtcctctccaacccggaccactgagaaaaagaagaatacacctatatctgccatg
ggagatgctgggaagggagccatggctggaggagagccttcacagatggagaaaatgaag
aaggggcgagtggcaacttctgctgcttctgggggtcatgggtccccactgagaagatgc
gagcctcctgaagatatttccaagaggttgtcttctcctgtgaaatccaagataacttca
aaaacatatccacagtcgccaaagacagcgaagcccacatacttagggtctcctgtgaag
tattactttccacccattgcaaacgaagaaacaccaaagaagaaggcagagaaggagaag
agaaataaggaaaaggaaggtgcccctggtcagcagagcactgtcctacctagagaagaa
agcctagagaagcgcatggctgacaagtatgccaccgagaagtatgtagcagataagcat
gcaactgagaaacattctgcccctggaggaaaggctgagcacagtgcaggaaaacccaca
gcaggcaccactgatgcaggagaggctgcaaagatcctagctgaaaagagacgtcaggct
cggctacagaaggaacaagaggagcaagagcgactggaaaaggaagaacgagaaaggctg
gaaaaagaggaattgaaaagaaaggcagaagaggaaaggctgcgcatagaaatggcctat
aaacgagaacaggaaaaaaagcggcaggaggaagaagagaaaagaaaagcagaagagaag
gcaaaagagaaggctgaggaggagctcttgtcaaaagagaagcaagaaaaggaaaaacaa
gaacaagaaaagaaggaaaaagccatgattgaaaaacagaaagaagcagcagaagcaaag
gcgcaggatgctgctaaacagatgcgtttagaaagagaacagatcatgctgcagattgag
caggaacgactggagaggaagaagagaatagatgaaatcatgaagagaacaaggaagagt
gatgcgtctctagaagtgaagaaggaagaccccaaagtggagctgcagcctcctccagat
gttgaaaataaagcaaacaaagcaaagccagttgtccccaacaagatcgaaatcaatgtg
ttgaacacctgccagaaagtaagtggctcagagcgtgctgctccagaaacctttccccaa
gacattttctctactggccttaaaccagttgggggacctgttcatctggatgtccttgat
gggaaatcaaacagtctggatgactcaactgaagacgttcagtctatggatgtgagtcct
gtttccaaagaagaacttatctccatcccagagttttcaccagtgagtgaaatgattcct
gggatgtctctggaccaaaatggaactggtaatgcccgggcacttcaagatatcttagat
ttcactggccctcccgcattccccaagaaatccagtgaaaacctcagccttgatgactgt
aacaaaaacctcatcgaaggatttaacagtcccgggcaagaaactaccctgaataccttc
tgttga

DBGET integrated database retrieval system