KEGG   Mus musculus (house mouse): 78286
Entry
78286             CDS       T01002                                 
Symbol
Nav2, 5330421F07Rik, HELAD1, POMFIL2, RAINB1, RAINB2, Unc53H2, mKIAA3015
Name
(RefSeq) neuron navigator 2
  KO
K19483  neuron navigator 2 [EC:5.6.2.4]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    78286 (Nav2)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     78286 (Nav2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    78286 (Nav2)
SSDB
Motif
Pfam: CH AAA_22 AAA_14 AAA_18 AAA_16 CAMSAP_CH AAA PhoH AAA_28 AAA_24 BrxL_ATPase AAA_19 IstB_IS21 AAA_33 AAA_5 Mg_chelatase RNA_helicase AAA_25 Nnf1 DUF6262
Other DBs
NCBI-GeneID: 78286
NCBI-ProteinID: NP_001104486
MGI: 2183691
Ensembl: ENSMUSG00000052512
UniProt: Q8BYE8 Q8BJG0 Q6ZPE7 V9GXT3
Position
7:48608796..49259838
AA seq 2371 aa
MESISESSQQQRRKPVTHGLEDQKRIYTDWANHYLAKSGHKRLIKDLQQDVTDGVLLAQI
IQVVANDKIEDINGCPKNRSQMIENIDACLNFLAAKGINTQGLSAEEIRNGNLKAILGLF
FSLSRYKQQQQQQQQQPEKQPLSSSPLPPAGSQVAGAPSQCQAGTPQHQGLATPQAPCQL
LQPVSHQQGKTQVEMQSRLPGPTARVAAAGSEAKTRGGSAAANNRRSQSFNNYDKSKPVT
SPPPPAPPSNHEKEPLASSASSHPGMSENVPAPLENSPSVPVNCSSSAIPQPSMTSKPWR
SKSLSVKHTATSAMLSVKPAGPEAPRPTPEAMKPAPNNQKSMLEKLKLFNSKGGSKAGEG
SASRDTSCERLEILPSFEETEELEATANRALSTVGPASSSPKIALKGIAQRTFSRALTNK
KSSPKGNEKEKEKQQREKEKEKEKEKGKDLTKRVSVTDRPDLKEETKADLSGVAVTEMPK
KSSKIASFIPKGGKLNSTKKEATAPSHSGIPKPGMKNVSAKSPSAPIPPKEGERSRGKLS
SGLPPQKAQLDSRHSSSSSSLASSEGKGPGGTSLNPSISSQTVSGSVGTTQTTGSNTVSV
QLPQPQQQYNHPNTATVAPFLYRSQTDTEGNVTAESSSAGVSMEPSHYTKSGQPALEELT
EDPEARRLRTVKNIADLRQNLEETMSSLRGTQVTHSTLETTFDTNVTTEISGRSILSLTG
RPTPLSWRLGQSSPRLQAGDAPSMGNGYPPRANASRFISAEAGRYVYSAPLRRQLASRGS
SICHVDVSDKADDDVDLEGISMDAPGYMSDGDVLSKNIRSDDITSGYMTDGGLGLYTRRL
NRLPDGMAVVRETLQRNTSLGLGDADSWDDSSSVSSGISDTIDNLSTDDINTSSSISSYA
NTPASSRRNLDVQTDAEKHSQVERNSLWSGDDIKKSDGGSDSGVKMEPGSKWRRNPSDMS
DESDKSVSGKKNPVLSQTGSWRRGMTAEVGITMPRTKPSAPTGTLKTPGTGKTDDAKVSE
KGRLSPKASQVKRSPSDAGRSSGDESKKTLPSSSRTPTVNANSFGFKKQSGSAAGLAMIT
ASGATVTSRSATLGKIPKSSALVGRPTGRKTSMDGAPNQDDGYLSLSSRTNLQYRSLPRP
SKSNSRNGAGNRCSTSSIDSNMSSKSAGLPVPKLREPSKASLGSSLPGLVNQTDKEKGIS
SDSESVASCNSVKVNPATQPVSSSAQATLQPGTKYADVASPTLRRLFGGKPTKPIATAET
MKSAVVISNPHATLTQQGNLESPSGSGVLSSGSSSPLYSKNVDLNQSPLASSPSSAHSGP
SNSLTWGTSSSAVSKDGLGFQSVSSLHTSCESIDISLGSGGGLSHNSSPGPVASTKEDSL
MPFVRTSSVKTTLSESPLSSPAASPKFCRSTLPRKQDSDPHLDRNTLPKKGLRYTPTSQL
RTQEDAKEWFRSHSAGGLQDTATNSPFSSGSSVTSPSGTRFNFSQLASPTAVTQMSLSNP
TMLRTHSLSNADGQYDPYTDSRFRNSSMSLDEKSRTMSRSGSFRDGFEEVHGSSLSLVSS
TSSIYSTPEEKCQSEIRKLRRELDASQEKVSALTTQLTANAHLVAAFEQSLGNMTIRLQS
LTMTAEQKDSELNELRKTIELLKKQNAAAQAAINGVINTPELNCKGNGSAQATDLRIRRQ
HSSDSVSSINSATSHSSVGSNIESDSKKKKRKNWVNELRSSFKQAFGKKKSPKSASSHSD
IEEMTDSSLPSSPKLPHNGSTGSTPLLRNAHSNSLISECMDSEAETVMQLRNELRDKEMK
LTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVSISAS
PRQSLGLSQHSLNLTESTSLDMLLDDTGECSARKEGGRHVKIVVSFQEAMKWKEDSRPHL
FLIGCIGVSGKTKWDVLDGVVRRLFKEYIVHVDPVSQLGLSSDSVLGYSIGEIKRSNASE
TPELLPCGYLVGENTTILVTVKGLTENSLDSLVFESLIPKPILQRYVSLLTEHRRIILSG
PSGTGKTYLANRLSEYVVLREGRELTDGVIATFNVDHKSSKELRQYLSNLADQCNSENNA
VDMPLVIILDNLHHVSSLGEIFNGLLNCKYHKCPYIIGTMNQATSSTPNLQLHHNFRWVL
CANHTEPVKGFLGRFLRRKLMETEISGRVRNAELVKIINWIPKVWHHLNRFLEAHSSSDV
TIGPRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQLYGRRAPWEDPAKWVMDT
YPWAASPQQHEWPPLLQLRPEDVGFDGYSLPREGSTSKQVPPSDTEGDPLMNMLMRLQEA
ANYSSPQSYDSDSNSNSHHDDILDSSLESTL
NT seq 7116 nt   +upstreamnt  +downstreamnt
atggaatcgatttctgagtcaagtcaacagcagaggagaaagccagtcactcacggcctg
gaagatcaaaagaggatctacacggattgggccaatcattacctcgctaaatccggccac
aaacgcctcatcaaggacctccagcaagatgtgaccgatggcgtgctcctggcccagatc
atccaggttgtagcaaatgacaagattgaagacatcaatggctgtccaaagaacagatcg
caaatgattgaaaacatagatgcctgcttgaatttcctggcagctaagggaatcaacacc
caggggctgtctgcagaagagatcaggaatgggaacctcaaggccattctaggcctcttc
ttcagcctctcccgatacaagcagcagcagcagcagcagcagcaacagcctgagaagcag
cccctctcctcatctcctctgccacctgccgggtctcaggtggccggggcgccttcccag
tgccaggctggcactcctcagcatcaggggctggccactccccaagccccgtgccagctc
ctccagccagtttcacatcagcaaggaaagacacaagtggaaatgcagtccagactccca
ggtcctaccgcaagggtggccgctgcaggcagcgaggccaaaactcgcggagggtcagct
gctgccaacaaccgtcggagccagagctttaacaactacgacaagtccaaacctgtcacc
tctccacccccacccgcaccaccaagtaaccatgagaaagagccactggcaagctcagcc
tcctcccatccaggaatgagcgaaaatgtccctgcgcccttggagaacagcccttccgtc
cctgttaactgctcctcctcagccatcccccagcccagcatgacctccaagccttggcgt
agcaagtccctcagcgtgaagcacactgccacgtcagccatgctgtccgtcaaacccgct
gggcccgaggcccccaggcccacacctgaagccatgaagcctgcccctaacaatcagaaa
tccatgttggaaaagctcaaacttttcaacagcaagggaggctccaaagcaggtgagggc
tcagcatcccgggacacgagctgcgagcgactagagatcctgcccagcttcgaagagact
gaagagttggaggccacagccaacagggcactttctaccgtgggccctgcatccagcagc
cccaagattgcactcaagggcattgcacagaggactttcagcagggcgcttaccaataag
aagagctccccaaagggtaatgagaaagagaaggagaagcagcagcgggagaaggagaag
gagaaagagaaggagaagggcaaggacctcaccaagagagtctccgtgaccgacaggcct
gacctcaaggaagaaaccaaggcagatctcagtggggtggctgtgactgagatgccgaaa
aagtcctccaagatcgccagctttatccccaaagggggcaagctcaacagcaccaagaag
gaggctacagctccgtcccacagcggcataccaaaaccaggaatgaagaacgtgtctgcg
aagtccccaagtgcccccatacctcccaaggaaggagagaggagcagagggaagctgagc
tcagggctccctccccagaaggcccagctggacagcaggcactctagctcctcctccagc
ctggcatcctcggagggaaaaggccccggagggaccagtctaaaccccagcatcagcagc
cagaccgtcagcggctccgtcgggaccacgcagaccactggaagcaataccgtcagtgtc
cagctacctcagcctcagcagcaatacaaccatcccaacacagccacggttgcacctttt
ctgtacaggtcccagacggacaccgaagggaatgtcactgccgagtccagctcagcgggt
gtgagcatggagcccagccactacaccaagagtggacagcctgctctggaggaactcact
gaagaccccgaggctcggcgacttcggacagtaaagaacatcgcagacctacgacagaat
ttagaagagaccatgtccagtttacggggaactcaggttacacacagcacattagaaacc
acgtttgacaccaacgtcaccactgagataagcggccgcagcatcctcagcctcacagga
cgacccactcctctgtcctggagactcggacagtccagcccccggctccaggcaggagat
gccccttcaatgggcaacgggtatccacctcgagccaacgccagccgcttcatcagtgcc
gaggcaggccgctacgtgtactctgcccctctgagaaggcagctggcctctaggggcagc
agcatctgccacgtggatgtctcggacaaggcagacgatgacgtagacctagaaggcata
agcatggacgccccaggctacatgagtgatggagatgtcctgagcaagaacatccgaagc
gatgacatcactagcgggtatatgacagatggtggactcggcctttacacccgtcgcctg
aaccggcttcctgatgggatggctgtggtgcgagagaccctacaacgaaatacctccctg
ggcctcggagatgctgacagctgggatgacagcagctccgtcagcagcggcatcagcgac
accatagacaacctcagcacggatgacatcaacaccagctcctccatcagctcctacgcc
aacacgcctgcctcctcccggagaaacctggatgttcagactgacgctgagaagcactca
caggtggagaggaattccctatggtctggtgacgacatcaagaaatcagatggaggctca
gacagtggtgtgaagatggagccgggctccaagtggaggcggaatccttcagacatgtct
gatgagtcggacaaaagtgtgtctggcaagaagaatccagtcctctcacagacaggctca
tggcggagaggcatgacggcagaggtgggcatcaccatgccaaggaccaagccatcggct
ccgacgggcacactgaagactccagggactggaaaaacagatgacgccaaggtgtctgag
aagggaaggctttcgcccaaagcttcccaggtcaagcgctccccatcggatgctggccgc
agcagcggggatgaatccaaaaagaccctccccagcagctctaggacgcccacggtcaat
gccaacagctttgggttcaagaaacagagcggctctgctgctgggctggccatgatcaca
gccagtggggccaccgtcaccagcaggtctgccacactgggtaaaatccccaagtcgtcc
gccctcgtcggtcggcccacgggtcggaagacaagcatggatggagccccaaaccaggat
gatgggtatctgtctctcagctcccggacgaacttacagtaccggagcctgcctaggccc
agcaagtccaacagccggaatggagcagggaatagatgcagcaccagcagcatcgactct
aacatgagcagcaagtcggcaggcctgccagtgcccaagctgagggagccctccaaagca
tcccttggcagctccctaccagggcttgtcaaccagacggacaaggagaaaggcatctct
tcagacagcgagagcgtggcttcctgtaactctgtgaaagtgaacccagccacccagccg
gtgtccagctcagctcaggccactctgcagccagggaccaagtatgcagatgtggcctct
cccacactccgcagactctttggtgggaagcctaccaagcccatcgccacagccgaaacc
atgaaaagtgcagtggtcatctccaaccctcatgccaccctgacccagcaaggtaaccta
gagtccccctcagggagcggtgtcctgagcagtgggagcagcagccctctctacagtaag
aacgtggacctcaaccagtctcctctagcgtccagtcccagctcagcccactcaggccct
tctaacagcctcacctggggtaccagctcgtcggcagtgagcaaggacggcctgggcttc
cagtctgttagcagcctgcacaccagctgtgagtctattgacatatccctcggcagcgga
gggggcttgagccacaactcctcccctggtccagtggcctccactaaggaagactccttg
atgccttttgtccgcaccagcagtgtgaagaccacactgtcggaaagccctctctcttcc
cctgctgctagccctaagttctgcagaagtactctgcccaggaaacaggacagtgacccg
caccttgataggaacactttgcctaagaaaggactcaggtatacacccacctcccagctt
cgcacgcaggaagacgccaaagaatggttccggtcccactcagctgggggcctgcaggac
actgctaccaattcccccttttcctccggctccagcgtcacttctccttcaggaacaaga
ttcaacttctctcagcttgcgagccccaccgctgtcacccagatgagcttgtccaaccca
accatgctgaggacccacagcctgtccaacgcagacggccagtatgacccctacaccgac
agccgcttccggaacagctccatgtctctggatgagaagagccgaacaatgagtcggtca
ggctccttccgggatgggtttgaggaagttcatggatcctccctgtccttggtttccagc
acatcctccatctactccacgccagaagaaaaatgccagtcagagattcgaaagctgagg
cgagagctggatgcctcccaggaaaaggtgtctgcgctgactacccagctgactgcaaat
gctcaccttgtggcagccttcgagcagagtctgggaaacatgaccatcaggctacagagt
ttaactatgaccgctgagcagaaggattcagaactgaacgagttaagaaaaaccatcgag
ctgctgaagaaacagaatgcagctgcccaggctgccattaatggagtgattaacacgcca
gagctcaactgcaaaggaaatggcagtgcccaggctacagacctacgcatccgcaggcaa
cactcctccgacagtgtctccagtatcaatagcgccaccagccactcaagtgtgggcagc
aacatagagagcgactcaaagaaaaagaagaggaaaaactgggtcaatgagttgcgcagc
tccttcaagcaagcctttggaaagaagaagtcccccaagtcagcgtcctctcactcagac
atcgaggagatgacggattcttcattgccttcctcaccaaaattgccacacaatgggtct
acaggctccaccccactgctgaggaatgcccactcaaactctctcatttccgagtgtatg
gacagcgaagctgagacggtcatgcagttacgaaatgagctgagagacaaggagatgaag
ctgacagacatccgcctggaagccctcagctctgctcaccagttggaccagctccgggag
gccatgaacaggatgcagagtgaaatcgagaagctgaaagccgagaatgaccgactgaag
tctgagtctcaaggcagtggctgcagccgggccccctcccaggtgtccatctccgcctcc
ccgaggcagtctttagggctctcccagcacagcctgaacctcacagagtctactagtcta
gacatgttgctggatgacactggtgaatgctcggctcggaaggaaggaggcaggcatgtt
aagatagttgtcagctttcaggaggcaatgaagtggaaggaggactccagaccacacctc
ttcctcattggctgcatcggagttagtggcaaaaccaagtgggacgtgctcgatggggtg
gttagacggctgttcaaagaatacatcgttcatgtggacccggtgagtcagctggggctg
agttcagacagtgttctcggctacagcattggtgagatcaaacgtagcaacgcctcagag
acccccgagctcctcccttgtggctaccttgtgggagagaacaccactatcttggtgacc
gtcaaagggctcacggaaaacagcctggactctctggtgtttgagtccctgatccccaag
cccatcctgcagcgctacgtatccctgctgacggagcaccggcggatcatcctctcgggc
cccagcggcactgggaaaacctacctggccaaccggctctctgagtacgtggtacttcgg
gaaggacgggagttgacagatggcgtcattgcgacctttaacgtggaccacaagtccagc
aaggagctgcgccagtatctgtccaacctggccgaccagtgcaacagcgagaacaacgct
gtggatatgcctctggtgatcatcctggacaacctgcaccacgtcagctctctgggcgag
atcttcaacgggctgcttaactgcaaataccacaaatgcccttacatcatcggcacgatg
aaccaggctacctcttccacccccaacctgcagcttcatcataacttcaggtgggtgctt
tgtgccaaccacacggagcccgtgaagggtttcctcggccgcttcctgaggaggaagctc
atggagacggagatcagtgggcgggtgcgcaatgcagagctggtgaagatcatcaactgg
atcccgaaggtctggcatcacctcaaccgcttcctggaggcccacagctcctcagatgtc
accatcggtccccggctcttcctgtcatgtcccattgatgtggatggttccagagtgtgg
ttcactgacctgtggaactactccataatcccctacctcctggaagctgtcagagaagga
ctccagctctacggaaggcgtgccccctgggaggaccccgccaagtgggtaatggacacc
tacccatgggccgccagcccacagcagcacgagtggcccccactcctgcagctccggcct
gaggacgtgggtttcgatggctactccctgcctcgggaggggtcaacaagcaagcaggtg
ccccccagcgacactgaaggagatccactgatgaacatgctgatgaggttgcaggaggcg
gccaactactccagcccccagagctatgacagcgactccaacagcaacagccaccatgac
gacatcctggactcgtccttggagtccactctgtga

DBGET integrated database retrieval system