KEGG   Mus musculus (mouse): 78303
Entry
78303             CDS       T01002                                 

Gene name
H2bu2, 1500011O09Rik, AI413321, Hist3h, Hist3h2ba
Definition
(RefSeq) H2B.U histone 2
  KO
K11252  histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05203  Viral carcinogenesis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    78303 (H2bu2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    78303 (H2bu2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    78303 (H2bu2)
  09165 Substance dependence
   05034 Alcoholism
    78303 (H2bu2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    78303 (H2bu2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    78303 (H2bu2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    78303 (H2bu2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   78303 (H2bu2)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Other DBs
NCBI-GeneID: 78303
NCBI-ProteinID: NP_084358
MGI: 1925553
Ensembl: ENSMUSG00000056895
Vega: OTTMUSG00000005770
UniProt: Q9D2U9
Structure
PDB: 

Position
11; 11 B1.3
AA seq 126 aa
MPEPSRSTPAPKKGSKKAITKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccggagccttcccgctccactcccgccccgaagaaaggctccaagaaagccatcacc
aaggctcagaaaaaggatggcaagaaacgcaaacggggccgcaaggagagctactccatc
tacgtgtacaaggtgctgaagcaggtgcatccggacaccggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaatgacatcttcgagcgcatcgccagcgaggcctcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgcgaggtgcagacggccgtgcgc
ctgctgctgcccggggagctggccaagcatgccgtgtccgagggcaccaaggcagtcacc
aaatacaccagctccaagtga

DBGET integrated database retrieval system