KEGG   Mus musculus (mouse): 78303Help
Entry
78303             CDS       T01002                                 

Gene name
Hist3h2ba, 1500011O09Rik, AI413321
Definition
(RefSeq) histone cluster 3, H2ba
  KO
K11252  histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05034  Alcoholism
mmu05203  Viral carcinogenesis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    78303 (Hist3h2ba)
  Immune diseases
   05322 Systemic lupus erythematosus
    78303 (Hist3h2ba)
  Substance dependence
   05034 Alcoholism
    78303 (Hist3h2ba)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    78303 (Hist3h2ba)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   78303 (Hist3h2ba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 78303
NCBI-ProteinID: NP_084358
MGI: 1925553
Ensembl: ENSMUSG00000056895
Vega: OTTMUSG00000005770
UniProt: Q9D2U9
Structure
PDB: 

Position
11; 11 B1.3
AA seq 126 aa AA seqDB search
MPEPSRSTPAPKKGSKKAITKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccggagccttcccgctccactcccgccccgaagaaaggctccaagaaagccatcacc
aaggctcagaaaaaggatggcaagaaacgcaaacggggccgcaaggagagctactccatc
tacgtgtacaaggtgctgaagcaggtgcatccggacaccggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaatgacatcttcgagcgcatcgccagcgaggcctcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgcgaggtgcagacggccgtgcgc
ctgctgctgcccggggagctggccaagcatgccgtgtccgagggcaccaaggcagtcacc
aaatacaccagctccaagtga

DBGET integrated database retrieval system