KEGG   Mus musculus (mouse): 78308
Entry
78308             CDS       T01002                                 

Symbol
Gpr108, 1810015L19Rik, AA589464, C79132, Lustr2
Name
(RefSeq) G protein-coupled receptor 108
  KO
K22986  G protein-coupled receptor 108
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    78308 (Gpr108)
G protein-coupled receptors [BR:mmu04030]
 Others
  Others
   Orphan GPCRs
    78308 (Gpr108)
SSDB
Motif
Pfam: Lung_7-TM_R GpcrRhopsn4
Other DBs
NCBI-GeneID: 78308
NCBI-ProteinID: NP_084360
MGI: 1925558
Ensembl: ENSMUSG00000005823
UniProt: Q91WD0
Position
17; 17 D
AA seq 569 aa
MAVSERRGLSGESPTQCRWGYLSLLVLTLSGCSGRIHRLTLTGEKRADIQLNSFGFYTNG
SLEVELSLLRLSLQETEKKLPKVGFSLSRVRSGSVRSYSRRNSHECPLDRNSSNFLVLFL
INIKDLQVQVRKYGEQKLFISPGLLPEAPTQSGPPKPDPAGTPKDNHVIHPSPTEMSAVK
ENQTAPQVSGDKTTPGEHRHSSERQPPTQDPSGKEKDQVLGLGHLNDSYNFSFHIVISSR
AEEGQYSLNFHNCHNSIPGQEQPFDLTVMIREKNPEGFLSAAEIPLFKLYLIMSACFLAA
DIFWVSVLCKNTYSVFKIHWLMAALAFTKSVSLLFHSINYYFINSQGHPIEGLAVMHYIT
HLLKGALLFITIALIGSGWAFVKYMLSDKEKKIFGIVIPLQVLANVAYIVIESREEGASD
YGLWKEILFLVDLICCGAILFPVVWSIRHLQDASGTDGKVAVNLARLKLFRHYYVMVICY
IYFTRIIAILLQVAVPFQWQWLYQLLVESSTLAFFVLTGYKFQPAGDNPYLQLPQEDEED
VQMEQVMTDSGFREGLSKVNKTASGRELL
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggcagtgagcgagaggagggggctcagcggcgagagcccaacgcagtgccgatgggga
tacttgtcgctgctggtgctgacgctgagcggctgctcaggccgtatccaccggctgact
ctcacaggggagaagcgagctgacatccaactgaacagcttcggattctacaccaatggt
tccctggaagtagagctgagcttactgcgactcagcctccaggagacagaaaagaagttg
ccaaaggtggggttcagcttgagcagagttcggtctggcagtgtccgctcctactcgaga
cggaactcccatgaatgccctctggatagaaacagcagcaacttcctggtcctgttcctc
atcaatatcaaggacctgcaggtccaagtccgaaaatatggggagcagaagttgttcatc
tcccctggccttctccctgaagctcccacccagtcaggtcccccgaaaccagacccagca
ggcacccccaaggacaaccacgtcattcacccatctcctacagagatgtctgcagtcaag
gagaatcagacagcgccccaggtttcaggggataaaactaccccaggggaacacaggcac
tcatccgagagacagccacccacgcaggaccccagtgggaaggagaaggatcaggtgttg
ggactgggccacctcaatgactcctacaacttcagtttccacattgtgatcagctccagg
gctgaggaaggccagtacagcctcaacttccacaactgtcacaactccatcccaggccag
gagcagccattcgacctcactgtgatgatccgggagaagaatccagaaggcttcttgtca
gcagccgaaatccccctcttcaaactctacctgatcatgtctgcctgctttctggccgca
gacatcttctgggtgtccgtgctctgcaagaacacatacagtgtcttcaagatccactgg
ctcatggcagccctggcgttcaccaagagtgtctccctactcttccacagcatcaactac
tacttcatcaacagccagggccaccccatcgaaggcctcgcggtcatgcactatatcaca
cacctgctgaagggcgcccttctcttcatcaccatcgccttgatcggctcaggctgggcc
tttgtgaagtatatgctgtcggacaaggagaagaagatttttggcattgtgattcccctg
caggtcctggctaatgtagcatacattgttattgagtcccgtgaggagggtgccagcgac
tatggactctggaaggagatcttgttcctggtggatctcatctgctgtggtgccatcctt
ttcccggtggtctggtccattcggcatctgcaggatgcatccggcactgatgggaaggtg
gcagtgaacctggccaggctgaagctgttccgacattactacgtcatggtcatctgctat
atctactttacacgtatcatcgccattctgctgcaagtagcagtgcccttccagtggcag
tggctgtaccagctcttggtggagagttccacactggccttcttcgtgctcactggctac
aagttccagccggctggggacaacccatacctgcagctgccacaggaggatgaggaggac
gtacagatggagcaagtgatgacagactctgggtttcgggaaggcctgtccaaagttaac
aagacagccagtggccgggagctgttgtga

DBGET integrated database retrieval system