KEGG   Mus musculus (house mouse): 78334
Entry
78334             CDS       T01002                                 
Symbol
Cdk19, 2700084L06Rik, CDK11, Cdc2l6, mKIAA1028
Name
(RefSeq) cyclin-dependent kinase 19
  KO
K02208  cyclin-dependent kinase 8/11 [EC:2.7.11.22 2.7.11.23]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    78334 (Cdk19)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    78334 (Cdk19)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     78334 (Cdk19)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     78334 (Cdk19)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   78334 (Cdk19)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    CDK-module
     78334 (Cdk19)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo
Other DBs
NCBI-GeneID: 78334
NCBI-ProteinID: NP_001161776
MGI: 1925584
Ensembl: ENSMUSG00000038481
UniProt: Q8BWD8 B7ZMT1 Q8BKC7
Position
10:40225283..40359814
AA seq 501 aa
MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGIS
MSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKP
MQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLF
NSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQED
IKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKH
KVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLN
EDEPEEKGDKNQPQQQNPHQQPAAPAQQTAAPPQAPPPQQSSAQTNGTAGGATAGGGGAG
AGLQHSQDPGLNQVPPNKKPRIGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQST
LGYSSSQQSTQYHSSHQTHRY
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggattatgatttcaaggcgaagctggcggcggagcgggagcgggtggaggatctgttt
gagtacgaagggtgcaaagtgggacgcggcacctacgggcatgtctacaaggcgaggcgg
aaagatggaaaagatgaaaaggaatatgcacttaagcaaatcgaaggcacaggaatatct
atgtcggcttgtagagagattgcacttttgagagaactgaagcaccctaatgtgatcgca
ttgcagaaggtgttcctttctcacagcgacaggaaggtgtggctgctgtttgactatgca
gaacatgacctttggcatattattaagtttcaccgtgcatcaaaagcaaataaaaagccc
atgcagttaccaagatccatggttaaatcactgctgtaccagatcctcgatggcatccat
tacctccacgcaaactgggtgctccacagggacctgaaaccagcaaatatcctagtaatg
ggagaaggtcctgaaagggggagagtcaaaatagctgacatgggttttgccaggttattc
aattctcccctaaagccactcgcagatttggatccagtggttgtgacattttggtatcgg
gctccggaacttttacttggtgccaggcattacacaaaggccattgacatctgggcaata
ggctgcatatttgctgaactcttgacttcagaacccatttttcactgtcgtcaggaggat
ataaaaacaagcaatccttttcatcatgatcagttagatcgaatatttagtgtcatgggg
tttcctgcagataaagactgggaagatattagaaaaatgccagagtacccaacacttcag
aaagactttcgaagaacaacgtacgccaacagcagcctcataaaatacatggagaagcac
aaggtcaagcctgacagcaaagtgttcctcctgcttcagaaactcctcaccatggatcca
accaagagaatcacctcagagcaggctctgcaggacccttacttccaggaagaccccctg
ccaacattagatgtgttcgctggctgccagattccgtaccccaaaagagaattccttaat
gaagatgaaccagaagagaaaggtgacaagaaccagccacagcagcagaacccacatcag
caacctgcagcccccgcacagcagacagcagcccccccacaggctcctccaccacagcag
agcagtgcccaaaccaatggaactgctgggggagccactgcgggaggcgggggcgctgga
gcggggctgcagcacagccaggaccccgggctgaatcaggtgcctccaaacaagaagccc
cggattgggccttccggtgcaaactcaggcgggcccgttatgccgtcggattatcagcat
tccagttctcgcctgaattaccaaagcagcgtacaggggtcctctcagtcccagagtacg
ctaggctactcttcatctcaacagagtacccagtaccactcatctcaccagacccaccgg
tactga

DBGET integrated database retrieval system