KEGG   Mus musculus (mouse): 78369
Entry
78369             CDS       T01002                                 

Symbol
Icam4, 1810015M19Rik, Cd242, ICAM-4
Name
(RefSeq) intercellular adhesion molecule 4, Landsteiner-Wiener blood group
  KO
K06581  intercellular adhesion molecule 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    78369 (Icam4)
CD molecules [BR:mmu04090]
 Proteins
  78369 (Icam4)
SSDB
Motif
Pfam: ICAM_N
Other DBs
NCBI-GeneID: 78369
NCBI-ProteinID: NP_076381
MGI: 1925619
Ensembl: ENSMUSG00000001014
Vega: OTTMUSG00000063056
UniProt: Q9ERM2 Q14AB0
Position
9 A3; 9 7.69 cM
AA seq 262 aa
MESALLLPSLLLVAAYPRGGSPQQEWMQSPPAPSVTSAPFWVRLNPELEAVPPGGSAWLN
CSHNCPLPVHSSLRTQLRQGKIVNGSGWVSYQLLDVRAWNSKVRCVVTCAGETREATARI
TAYKRPRSVILEPPVLVGHKYTLRCYVTHVFPVGFLVVSLRRGGRVIYHESLERFTGSDL
ANVTLTYVMRAGLNDLWQPLTCHARLNLDGLVVRSSSAPVMLTVLALSPASIALASTSIA
TLVGILLAVGAVYVRKYLAVQT
NT seq 789 nt   +upstreamnt  +downstreamnt
atggagtctgcccttctgctcccgtcgcttttgctggtggctgcctatccgaggggtggg
agcccccagcaagagtggatgcaaagtcctcccgcgccttccgtgacctcagcacctttc
tgggtgcgtcttaatccagagctagaggccgtgcctcccgggggctcagcgtggcttaac
tgcagccacaactgccccctgccggtgcattccagcctgcgcacccaactgcggcaggga
aagatagttaatggatccggctgggtatcttaccagctactggatgtgagggcctggaat
tccaaggtgcgctgcgtcgtcacttgcgcaggagaaacccgagaggccaccgccaggatc
actgcttacaaacggcccagaagcgtgatcttggagcctccggtcctagtgggccacaag
tacactctgcgatgctatgtgacacacgtgttcccagtgggattcttggtggtgagcctg
agaagaggtggccgagtgatttatcatgaaagcctggagcgcttcaccggttcagatttg
gctaatgtcactttgacctacgtgatgcgggccggactcaacgacctctggcagccactc
acctgccatgcgcgcctcaatctcgacgggctagtggtgcgcagcagctcggcacctgtt
atgttgacagtcctcgctttaagcccagcctctatagccttggcctctacctccatcgca
accctggtggggatcctcctggctgtgggggctgtctacgtgcgcaagtacctggctgtg
cagacttag

DBGET integrated database retrieval system