KEGG   Mus musculus (mouse): 78372
Entry
78372             CDS       T01002                                 

Gene name
Snrnp25, 3300001G02Rik, AL033324, C16ORF33
Definition
(RefSeq) small nuclear ribonucleoprotein 25 (U11/U12)
  KO
K13153  U11/U12 small nuclear ribonucleoprotein 25 kDa protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    78372 (Snrnp25)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Minor spliceosome components
   Minor spliceosome specific factors
    78372 (Snrnp25)
SSDB
Motif
Pfam: Ubiquitin_4 ubiquitin Rad60-SLD_2
Other DBs
NCBI-GeneID: 78372
NCBI-ProteinID: NP_084369
MGI: 1925622
Ensembl: ENSMUSG00000040767
Vega: OTTMUSG00000005369
UniProt: Q8VIK1
Structure
PDB: 
1V2Y

Position
11; 11 A4
AA seq 123 aa
MVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQNATVLDLKKA
IQRYVQLKQEREGGVQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKL
RQK
NT seq 372 nt   +upstreamnt  +downstreamnt
atggtggtgcaagacccgctgctctgcgaccttccgatccaggttactctagaagaggtc
aactcccagattgcactggaatatggccaggcgatgactgtccgtgtgtgcaagatggat
ggagaggtaatgcctgtggtcgtcgtacagaatgccacggtcctggacctgaagaaggct
atccagagatacgtgcagctcaagcaggagcgggaaggcggcgttcagcacatcagctgg
tcctatgtatggcggacataccatctgacctcagctggggagaagctcacagaggacagg
aagaagctcagagattatggcatccggaaccgagatgaggtttcctttatcaagaagctt
aggcaaaagtga

DBGET integrated database retrieval system