KEGG   Mus musculus (mouse): 78394Help
Entry
78394             CDS       T01002                                 

Gene name
Ddx52, 2700029C06Rik, ROK1
Definition
(RefSeq) DEAD (Asp-Glu-Ala-Asp) box polypeptide 52
  KO
K14779  ATP-dependent RNA helicase DDX52/ROK1 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    78394 (Ddx52)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     78394 (Ddx52)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  90S particles
   Helicases
    78394 (Ddx52)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII AAA_19 HEM4
Motif
Other DBs
NCBI-GeneID: 78394
NCBI-ProteinID: NP_084372
MGI: 1925644
Ensembl: ENSMUSG00000020677
Vega: OTTMUSG00000000973
UniProt: Q8K301 Q3TKX4
Position
11; 11 C
AA seq 598 aa AA seqDB search
MDSYDLFRRLGAGAKFDVKRFSADATRFQVGKRKFDSESLEVLKGLDFFGNKKSVSDECG
ALQIHQEPPNEEKTQGVLLERSKEPKKKKRKKMTSEVPAQEDFDGGIQWTSSVEAKLQDE
KVSGEKKLTSGKLEHLRKEKVNFFRNKHKIHVQGTDLPDPIATFQQLDQEYKINSRLLQN
ILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQPTNKGFRALV
ISPTRELASQIHRELIKISEGTGFRIHMIHKAAIAAKKFGPKSSKKFDILVTTPNRLIYL
LKQDPPGIDLTNVEWLVVDESDKLFEDGKTGFREQLASIFLACTSPKVRRAMFSATFAYD
VEQWCKLNLDNVVSVSIGARNSAVETVEQELLFVGSETGKLLAMRELVKKGFKPPVLVFV
QSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFK
GVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTEDDKPLLRSVANVIQQAGCPVP
EYIKGFQKLLSKQKKKMIKKPLERESICTTPKYFLEQAKQKKVAGQNSKKKETLKEKS
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggattcctacgacctgtttcgccggcttggagccggcgccaagttcgacgtgaagcgc
ttctcagcagacgctactcgattccaggtaggaaaaaggaaattcgattccgagtctttg
gaggtcctgaagggactagacttcttcggaaacaagaagtccgtctcagatgaatgtgga
gcattgcaaatacaccaggagcccccaaatgaggagaaaacacaaggggtcctgttggaa
aggagtaaggagcccaagaagaaaaagagaaagaagatgacttcagaagttcctgctcaa
gaagactttgacggtggtatccagtggacatcctctgtagaagcaaagcttcaagatgaa
aaagtcagtggagagaagaagttaacttcaggaaagttggaacatctcagaaaggaaaag
gtcaacttctttcggaacaagcacaagatacatgtccaaggaactgatcttcctgaccca
attgctacatttcagcaacttgaccaggaatataaaatcaattctagattgctccagaat
attctagacgcaggcttccaagtgcccacaccaattcagatgcaagccattccagttatg
ctgcatggtcgggaacttctggcttctgctccaaccggatctgggaagacgttggcattt
agcatccccattttaatgcagctgaaacaaccaacaaataaaggctttagagccctggtt
atatccccaacccgagaacttgcaagccagattcacagagaattaattaaaatatctgag
ggtacaggattcagaatacatatgatccacaaagctgcaatagcagctaagaaatttgga
cctaaatcatctaagaagtttgatatccttgtgactactccaaatcgactgatctacttg
ttgaagcaggatccaccagggattgacctaacaaatgtcgagtggctggtagtagatgaa
tcagacaaactgtttgaagatggcaaaactgggtttagagagcagctggcttccattttc
ctggcctgcacatcgcccaaggtcagaagagcaatgttcagcgcaacttttgcgtacgac
gttgaacagtggtgcaagctcaacctggacaacgtcgtttccgtgtccattggagcaagg
aattctgcagtcgaaactgttgaacaagagcttctctttgttggatctgagactggaaaa
cttctggccatgagagaacttgttaaaaagggtttcaagccacctgttcttgttttcgtt
cagtccattgaaagagctaaagaacttttccatgagctcatatatgaaggtattaatgtg
gatgtcattcatgcagaaagaacacagcagcagcgagataacacagtccacagcttcaga
gcaggaaaaatttgggttcttatttgtacagccttacttgcaagagggattgactttaaa
ggcgtaaacctggtcatcaattatgattttcccaccagctcagtggagtacatccatagg
ataggtcggactggaagagcagggaataggggaaaggctgttacatttttcactgaagat
gataaaccattactaagaagtgttgccaatgttatccagcaggctggttgtcctgtgccc
gaatacataaaaggtttccagaaactactaagcaaacaaaagaaaaaaatgattaagaag
ccgttggaaagggagagcatttgtacaactccaaagtacttcttagagcaagctaaacag
aaaaaggttgctggccaaaacagcaagaagaaagaaactctcaaagagaaaagttaa

DBGET integrated database retrieval system