KEGG   Mus musculus (house mouse): 78405
Entry
78405             CDS       T01002                                 
Symbol
Ntf5, 2900040K06Rik, AI462899, NT-4, NT-5, NT4, NT4/5, Ntf-5, Ntf4
Name
(RefSeq) neurotrophin 5
  KO
K12457  neurotrophin 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    78405 (Ntf5)
   04014 Ras signaling pathway
    78405 (Ntf5)
   04151 PI3K-Akt signaling pathway
    78405 (Ntf5)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    78405 (Ntf5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    78405 (Ntf5)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   78405 (Ntf5)
SSDB
Motif
Pfam: NGF
Other DBs
NCBI-GeneID: 78405
NCBI-ProteinID: NP_937833
MGI: 97381
Ensembl: ENSMUSG00000074121
Vega: OTTMUSG00000059407
UniProt: Q80VU4
Position
7:45063119..45066603
AA seq 209 aa
MLPRHSCSLLLFLFLLPSVPMEPHPPSSTLPPFLAPEWDLLSPRVALSRGAPAGPPLLFL
LEAGAYGEPAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVL
GEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALT
ADSQGRVGWRWIRIDTACVCTLLSRTGRA
NT seq 630 nt   +upstreamnt  +downstreamnt
atgctccctcgccactcctgttctctcctccttttcctcttcctcctccccagcgtcccc
atggagccccaccccccatcctccaccctgcccccatttctggcccctgagtgggacctc
ttgtctccccgagtggccctgtcaaggggcgcccctgccgggccccctctcctcttcctg
ctggaggccggggcctatggagagccggcaggggccccagccaaccgcagccggcgcggg
gtgagtgagaccgcacccgcaagccgccggggtgagctggcagtatgcgacgcagtgagt
ggctgggtgaccgaccggcggacagctgtggacttgcgtgggcgcgaggtggaggtgctg
ggcgaggtgcctgcggcaggtggcagtcccctgcgtcagtacttcttcgagacgcgctgc
aaggccgaaagcgctggggaaggtggcccaggtgtgggcggagggggttgtcgcggcgtg
gatcggaggcactggctctcagaatgcaaggctaagcagtcctatgtgcgggcgttgact
gcagactcccagggccgcgtaggctggcgctggattcggatcgacacagcttgcgtctgc
acgctcctcagccgaacaggccgagcctga

DBGET integrated database retrieval system