KEGG   Mus musculus (mouse): 78412
Entry
78412             CDS       T01002                                 

Symbol
Cyren, 3110062M04Rik, AL023049, Mri
Name
(RefSeq) cell cycle regulator of NHEJ
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: MRI
Other DBs
NCBI-GeneID: 78412
NCBI-ProteinID: NP_001129083
MGI: 1925662
Ensembl: ENSMUSG00000046806
Vega: OTTMUSG00000022823
UniProt: Q8BHZ5
Position
6; 6 B1
AA seq 157 aa
METLKSKTKTRVLPSWMTAPVDERKVVSVKTATRKQTAAWAQRVGAATRAPATETVYCMN
EAEMVDVALGILIEGRKQEKPWEQRSLEATDKLQLSPPCSSSPGSSSEEEDSRISSLAPG
LSPPRGPEASDSPCSRSPEEEKEEEDALKYVREIFFS
NT seq 474 nt   +upstreamnt  +downstreamnt
atggaaaccctaaaatccaagaccaaaacgagggtcctcccctcttggatgacagcccct
gtggatgagagaaaggttgtatcagtgaagacagccacaaggaagcagacagccgcctgg
gcccagagagtgggggcagcaacaagagccccagccacggagaccgtgtactgcatgaat
gaagctgaaatggtagacgtggcactggggatcctgattgagggccgcaaacaggaaaag
ccctgggaacagcggtctctggaggccactgataagctgcagctctcccctccctgttcc
tcgtcccccgggagcagcagtgaggaagaagacagcaggatcagctctcttgctccaggc
ctcagccctccccggggaccagaagcttcggactctccctgtagcagaagcccggaggag
gagaaggaggaggaagacgcgttgaagtacgtcagggaaatatttttcagttag

DBGET integrated database retrieval system