KEGG   Mus musculus (mouse): 78506
Entry
78506             CDS       T01002                                 

Symbol
Micu3, 2900075B16Rik, Efha, Efha2
Name
(RefSeq) mitochondrial calcium uptake family, member 3
  KO
K23843  calcium uptake protein 3, mitochondrial
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    78506 (Micu3)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   78506 (Micu3)
SSDB
Motif
Pfam: EF-hand_8 EF-hand_6 EF-hand_7 EF-hand_1 EF-hand_4
Other DBs
NCBI-GeneID: 78506
NCBI-ProteinID: NP_084386
MGI: 1925756
Ensembl: ENSMUSG00000039478
Vega: OTTMUSG00000031719
UniProt: Q9CTY5
Position
8; 8 A4
AA seq 523 aa
MAALRRFLWPPPRLSPALAPQQPFLSPWGRPAGTAPGMSGRPFSCREEDEGAVAEAAWRR
RRWGELSIAAAAGGGLVGLVCYQLYGDPRADPSELAAPELEDPPRGRGLLPIPVAAAKET
VATGRAITEDLDLYATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEPKFAKTWKSLS
KQELSQMLSETPPVWKGSSKLFRNLKERGVISYTEYLFLLCILTKPHAGFRIAFNMFDTD
GNEMVDKKEFLVLQEIFRKKNEKRETKGDEEKRAMLRLQLYGYHSPTNSVLKTDAGELVS
RSYWDTLRRSTSQALFSDLAERADDITSLVADTTLLVHFFGKKGKAELNFEDFYRFMDNL
QTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSISEEKGITFDEFR
SFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKLSPHLVNTVFKIFDVDKD
DQLSYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggctgcgctgcggaggttcctgtggccgccgcctcggctgtcgccggcgctcgcccct
cagcagcccttcctctcaccgtgggggcggcctgcggggacggctcccgggatgtcgggc
cggcccttctcctgccgggaggaggacgagggggccgtcgcggaggcggcgtggcggcgg
cgacgctggggcgagctgagcatcgcggcggcggctggcggggggctggtcggccttgtg
tgctaccagctgtatggggaccccagagccgacccctcggagctagcggccccggaactc
gaggacccgccccgcggcagggggctgctgcccatcccggtggctgctgccaaggagacg
gttgctactggcagagccattactgaagacttggacctctatgctacatctcgagagaga
cggtttcgtttatttgcatctatagaatgtgaaggacagttattcatgactccatatgat
tttattctggctgttacaacagatgagcccaaatttgctaaaacgtggaagtcactttct
aaacaggaattaagtcagatgctctcagaaactccaccagtttggaagggatcatcaaag
ctttttcgaaatcttaaagaaagaggtgtgatttcttacacagaatatctttttctttta
tgtattttaacaaagccccatgcaggttttagaatagctttcaacatgtttgacactgac
ggaaatgagatggtggataaaaaagaatttttggtgcttcaggagatattcaggaaaaaa
aatgaaaagagagaaactaaaggagatgaagaaaaacgtgccatgctgcgtcttcaactt
tatggataccattctcctactaatagtgtacttaaaacagatgctggggaacttgtctcc
agaagctactgggataccctgagacgtagcacaagccaggcgctcttctcagacctcgca
gagcgtgctgatgacatcacaagcttagtagcagatactacacttctggtacactttttt
ggaaaaaaaggaaaagctgagctcaactttgaagatttttatagatttatggacaatcta
caaacagaagttctagaaatagaatttctttcctactctaatggaatgaatactatcagt
gaagaagattttgcccatattctcctgcggtatactaatgtggaaaatacatcagtattt
ttagaaaatgtgcgctacagtatatctgaagaaaagggcatcacatttgatgagttcagg
tcattcttccagtttctgaacaacttagaagactttgcaatagctctcaacatgtataac
tttgcaagccgctctataggacaagatgaatttaaacgtgctgtatacgtagctactgga
ctgaaactttcaccacatttggtgaacactgtcttcaagatttttgatgttgacaaagat
gaccaattaagttataaagaatttattggaattatgaaagacagactccatagagggttc
cggggttataaaacagtccagaagtatccgaccttcaaatcctgcctgaaaaaggaactt
cacagcagataa

DBGET integrated database retrieval system