KEGG   Mus musculus (mouse): 78541
Entry
78541             CDS       T01002                                 

Gene name
Asb8, 4930539L19Rik, AI788835, C430011H06Rik
Definition
(RefSeq) ankyrin repeat and SOCS box-containing 8
  KO
K10330  ankyrin repeat and SOCS box protein 8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    78541 (Asb8)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     78541 (Asb8)
SSDB
Motif
Pfam: Ank Ank_4 Ank_2 Ank_3 Ank_5 SOCS_box TIP49
Other DBs
NCBI-GeneID: 78541
NCBI-ProteinID: NP_001164181
MGI: 1925791
Ensembl: ENSMUSG00000048175
Vega: OTTMUSG00000032735
UniProt: Q91ZT9 A0A0R4J1W1 Q9D4Y2 Q8CDF0
Position
15; 15 F1
AA seq 288 aa
MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCTHGTLKPLHCA
CMVSDADCVELLLEKGAEVNALDGYNRTALHYAAEKDEACVEVLLEYGANPNALDGNRDT
PLHWAAFKNNAECVRALLESGASVNALDYNNDTPLSWAAMKGNLESVSILLDYGAEVRVI
NLKGQTPISRLVALLVRGLGTEKEDSCFELLHRAVGQFELRKNGIMPREVTKDQQLCEKL
TVLCSAPGTLKTLARYAVRRSLGLQYLPDAVKGLPLPVSLKDYLLLLE
NT seq 867 nt   +upstreamnt  +downstreamnt
atgagttccagcatgtggtatattatgcagagcattcagagcaaatactccctctccgaa
cgcctgatccgaaccatcgctgccatccgctccttcccacatgacaacgtagaggacctc
atcagagggggagcagatgtgaactgcacgcacggcacactgaagcccctccactgtgcc
tgcatggtgtccgacgccgactgcgtagagctcctcctggagaagggagcagaggtcaat
gccctggatggttacaaccgaacggccctccactatgcagcagagaaagatgaggcttgt
gtggaggtcctactggagtatggggcaaaccccaatgcactggacggcaacagagacacc
ccgcttcattgggcagcctttaagaacaatgctgagtgtgtgcgggctctcctggagagc
ggggcctccgtcaatgccctggattacaacaacgatacgccgctcagctgggctgccatg
aagggaaatcttgagagtgtcagcatccttcttgattatggtgctgaggtcagagtcatc
aacttaaaaggccagacacccatctcccgcctggtggctctgctagtgagaggacttgga
acagaaaaagaagactcctgctttgagctcctccatagagctgttggacagtttgaatta
aggaaaaacggcatcatgccccgagaagtgaccaaagaccagcagctgtgtgaaaaactg
actgtgttgtgctcagcaccagggacgcttaaaaccctcgcccgctatgctgtgcgccgt
agcctcggtctccagtacctgcccgacgcagtgaagggtctcccactgccagtgtctttg
aaggactacctgttactcttggagtag

DBGET integrated database retrieval system