KEGG   Mus musculus (house mouse): 78558
Entry
78558             CDS       T01002                                 
Symbol
Htra3, 2210021K23Rik, 9530081K03Rik, Prsp, Tasp
Name
(RefSeq) HtrA serine peptidase 3
  KO
K08785  HtrA serine peptidase 3 [EC:3.4.21.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    78558 (Htra3)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    78558 (Htra3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     78558 (Htra3)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   78558 (Htra3)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  DegP / HtrA
   78558 (Htra3)
SSDB
Motif
Pfam: Trypsin_2 PDZ_6 Trypsin PDZ_2 PDZ IGFBP Peptidase_M50 Kazal_2 Peptidase_S46 Tricorn_PDZ Kazal_1 DUF6288
Other DBs
NCBI-GeneID: 78558
NCBI-ProteinID: NP_084403
MGI: 1925808
Ensembl: ENSMUSG00000029096
UniProt: Q9D236
Position
5:complement(35809370..35837157)
AA seq 459 aa
MQARALLPATLAILATLAVLALAREPPAAPCPARCDVSRCPSPRCPGGYVPDLCNCCLVC
AASEGEPCGRPLDSPCGDSLECVRGVCRCRWTHTVCGTDGHTYADVCALQAASRRALQVS
GTPVRQLQKGACPSGLHQLTSPRYKFNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSS
GSGFIMSEAGLIVTNAHVVSSSSTASGRQQLKVQLQNGDAYEATIQDIDKKSDIATIVIH
PKKKLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRDGKELGLRDSDMDYI
QTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPSDRITRFLSEFQNKHVKDWKK
RFIGIRMRTITPSLVEELKAANPDFPAVSSGIYVQEVVPNSPSQRGGIQDGDIIVKVNGR
PLADSSELQEAVLNESSLLLEVRRGNDDLLFSIIPEVVM
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgcaggcgcgcgcgctgctccccgccacgctggccattctggccacgctggctgtgttg
gctctggcccgggagcccccagcggctccgtgtcctgcgcgctgcgacgtgtcgcgctgt
ccgagccctcgctgccctgggggctatgtgcctgacctctgcaactgctgcctggtgtgc
gctgccagcgagggcgagccctgcggccgccccctggactctccgtgcggggacagtctg
gagtgcgtgcgcggcgtgtgccgctgccgttggacccacactgtgtgtggcacagacggg
catacttatgccgacgtgtgcgcgctgcaggccgccagccgtcgtgcgttgcaggtctcc
gggactccagtgcgccagctgcagaagggtgcctgtccctctggtctccaccagctgacc
agtccgcggtacaagttcaacttcatcgccgatgtggtggagaagattgcgccagctgtg
gtccacatagagctctttctgagacaccccctgtttggccggaatgtgccgctgtccagt
ggctcgggcttcatcatgtcagaagccggtttgatcgtcaccaacgcccacgtggtctcc
agctccagcactgcctccggccggcagcagctgaaggtgcagctgcagaatggggatgcc
tatgaggccaccatccaggacatcgacaagaagtcggacattgccacgattgtaatccac
cccaagaaaaagctccctgtgttgctgctgggtcactcagcagacctgcggcctggcgag
ttcgtggtggccatcggcagcccctttgccctgcagaacaccgtgacaacgggcattgtc
agcactgcccagcgggatggcaaggagctgggtctccgggactcagacatggactatatc
cagaccgatgccatcatcaattacgggaactcaggaggacccctggtgaacctggatggc
gaggtcatcggcatcaacacgctcaaggttgcagctggcatctcctttgccatcccctca
gatcgcatcacacgcttcctctctgagttccaaaacaagcatgtgaaagactggaagaag
cgcttcattggcatccggatgcggaccatcacgccaagtttggtggaggaactgaaggcc
gccaacccagactttccagcggtcagcagtggaatatatgttcaagaggtggttcccaat
tcaccttctcagagaggaggcatccaagatggcgacatcatcgtcaaagtcaatggccgc
cccctggcggattccagcgagctgcaggaggcagtcctgaacgagtcttcactcctgctg
gaggtgcggcgaggcaatgatgatctcctcttcagcatcatccctgaggtggtcatgtga

DBGET integrated database retrieval system