KEGG   Mus musculus (mouse): 78600
Entry
78600             CDS       T01002                                 

Symbol
Pde6h, A930033D18Rik, PDEgamma
Name
(RefSeq) phosphodiesterase 6H, cGMP-specific, cone, gamma
  KO
K13760  retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    78600 (Pde6h)
SSDB
Motif
Pfam: PDE6_gamma
Other DBs
NCBI-GeneID: 78600
NCBI-ProteinID: NP_076387
MGI: 1925850
Ensembl: ENSMUSG00000064330
Vega: OTTMUSG00000023391
UniProt: P61249
Position
6:136929216..136940483
AA seq 83 aa
MSDSPSLSPPAPSQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDI
TVICPWEAFSHLELHELAQFGII
NT seq 252 nt   +upstreamnt  +downstreamnt
atgagtgacagcccttccctgagtcctccagcaccaagccagggccctactaccccacgc
aaagggccccccaagttcaagcagaggcagactcgacagttcaagagcaagcctcccaag
aaaggggtgaaagggtttggagatgacatcccaggcatggaggggctaggaacagatatc
acggtcatctgtccctgggaagcgttcagccatctggagctgcatgagcttgctcagttc
gggatcatatga

DBGET integrated database retrieval system