KEGG   Mus musculus (mouse): 78619
Entry
78619             CDS       T01002                                 

Symbol
Zfp449, 9530049C15Rik
Name
(RefSeq) zinc finger protein 449
  KO
K09230  SCAN domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    78619 (Zfp449)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    78619 (Zfp449)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_11 DZR zf-met zf-ribbon_3 zf-Di19 zinc_ribbon_9 Zn_ribbon_SprT DUF3268 zf-C2HE C1_4 zf-AN1 PyrI_C ROS_MUCR HalOD2
Other DBs
NCBI-GeneID: 78619
NCBI-ProteinID: NP_001346205
MGI: 1925869
Ensembl: ENSMUSG00000073176
Vega: OTTMUSG00000017518
Position
X; X A5
AA seq 398 aa
MDDMLLEELAPVGTVPMPPNLHLEEPSLQVMEPVQEPPVPDAWIPQAGPQDLNYSADAEC
QSFLDPGYQLPKLDMNFPLDHREEPWVKDLEDPKEMKQLLDSKIGFEMGIENEEDTSKEK
KLETLYPFVVTLEGNALHGPILQKDYVQLENQWETSPEDLQTDLTKLVDPQNPTLGETPE
SPSLEEPLTPKPPKKKSPGDKPHRCPQCGKCFARKSQLTGHQRIHSGEEPHKCPECGKRF
LRSSDLYRHQRLHTGERPYECTVCKKRFTRRSHLLGHQRTHSEEETYKCLECGKTFCHGS
SLKRHLKTHTGEKPHRCPNCGKSFSRLTALTLHQRTHTEERPFKCSYCGKSFRQRPSLVI
HLRIHTGEKPYKCTHCSKSFRQRAGLIMHQVTHFRGLL
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggatgacatgctcttggaagaactggcgccagttggaacagtacccatgccacccaac
ttgcacctggaggagccttcactccaggtgatggaacctgttcaggagcctccggtgccg
gatgcctggattccacaagctggcccccaggatctgaactacagtgctgatgctgaatgc
cagtcctttctggaccctggttatcagttaccaaagcttgacatgaacttcccattggat
catagagaagaaccatgggtaaaagacttagaggatcccaaagaaatgaaacaattactt
gattccaagattggttttgagatgggaatagaaaatgaagaagatacttcaaaggaaaaa
aaactggaaactttgtacccatttgttgtaactttagaagggaatgctctccatggtccc
attttgcagaaagactatgtgcagttagaaaaccaatgggaaacatccccagaggactta
cagacagacctaacaaaactcgtagatcctcagaacccaactctaggagagacacccgag
agccccagcctggaagaacctctcaccccgaagcctccaaagaaaaagagtcctggggac
aaacctcaccgatgtccccagtgtggcaaatgtttcgctcggaagtcacaacttacaggg
caccagcgaattcattcaggagaagaacctcacaagtgccctgaatgcggaaaaaggttc
ctgcgtagctctgacctttacagacaccaacgacttcacacaggagaaagaccctatgaa
tgcactgtatgtaaaaagcgattcactaggcgctcacaccttcttgggcaccagagaacc
cattctgaagaagaaacatataaatgtcttgagtgtggaaaaaccttttgtcatgggtca
agtcttaaaagacatctaaaaactcatacaggtgaaaagcctcatagatgtcctaattgt
gggaaaagttttagtcgcctgacggcacttactttgcaccagagaacacacacggaagag
agaccttttaaatgtagttactgtgggaaaagctttagacagagaccaagccttgtcatt
catttaagaatccatacaggggaaaagccatacaagtgtactcattgttctaaaagcttc
cggcagagagcaggccttattatgcaccaggtcacacactttagaggacttctttaa

DBGET integrated database retrieval system