KEGG   Mus musculus (house mouse): 78634
Entry
78634             CDS       T01002                                 
Symbol
Spaca7, 1700094C09Rik
Name
(RefSeq) sperm acrosome associated 7
  KO
K25515  sperm acrosome membrane-associated protein 7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    78634 (Spaca7)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   78634 (Spaca7)
SSDB
Motif
Pfam: SPACA7
Other DBs
NCBI-GeneID: 78634
NCBI-ProteinID: NP_077241
MGI: 1925884
Ensembl: ENSMUSG00000010435
UniProt: Q9D2S4
Position
8:12623036..12650739
AA seq 182 aa
MAANRGSRTFLSVFLLCCWQGAELQPIKTTSGPITEGSLNSTTENIPEALDEILAQEILE
PKTSAVSETSPRPRSSILTTVQTKEINAGIDENYQEEAFENYHEVLENIEHLPTKEESGK
NDRSTVANLHDHSSQTKHEPPSSPEGKGSSNDDVYGKLSVLDKILENIGQSEGSLELTES
IF
NT seq 549 nt   +upstreamnt  +downstreamnt
atggcagcgaatagaggatcgaggaccttcttatctgtcttcctgctgtgctgctggcaa
ggcgctgagctgcagccgatcaagacaacttcaggtccaattactgaaggttcactcaac
tcaacaacagaaaacatacccgaagcattagatgaaattctagcccaagagattttggag
cccaaaacatcagcagtgtctgaaacatcaccacgaccaagatcatcgatactgacaaca
gtacaaaccaaggaaataaatgctggtattgatgaaaactaccaagaggaagcctttgag
aactaccatgaggtcctggagaacatagaacacttgcctacaaaggaggaaagtggcaaa
aatgacagaagcacggttgcaaaccttcatgaccacagctctcagactaagcatgagcca
ccctcgtctcctgaaggaaaggggagttcaaacgatgatgtgtatgggaaactgtctgtt
ctggacaaaatccttgaaaacataggacaatctgaaggcagcctggagctaacagaaagc
atcttttag

DBGET integrated database retrieval system