KEGG   Mus musculus (house mouse): 78749
Entry
78749             CDS       T01002                                 
Symbol
Filip1l, 4631422O05Rik, Doc1
Name
(RefSeq) filamin A interacting protein 1-like
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: CortBP2 DMPK_coil Arm-DNA-bind_2
Other DBs
NCBI-GeneID: 78749
NCBI-ProteinID: NP_001035487
MGI: 1925999
Ensembl: ENSMUSG00000043336
UniProt: E0CYH7
Position
16:57173640..57393167
AA seq 1131 aa
MRSRSSNAEGSAPKQIPRHSKFQDSIQDMKHRTHKKDPSCESEGVLPRPVSEKSHTGKGH
HTEDLSRDDLLFLLSILEGELQARDEVIGILRAEKIDLALLEAQYGFVTPKKVLEALQRD
AFQAKSAPWQEDIYEKPMNELDKVVEKHKESHRRILEQLLMVERSHRQTIMEMEEEKRKH
KEYMKKSDEFINLLEQECERLKKLIDQETASQEKKEQEKEKRIKTLKEELTKLKSFALMV
VDEQQRLTAQLALQRQKIQALTTSAKETQGKLALAEARAQEEEQKATRLEKELQTQTTEF
HQNQDKIMAKLTNEDSQNRQLRQKLAALSRQIDELEETNRSLRKAEEELQDIKDKINKGE
YGNSGIMDEVDELRKRVLDMEGKDEELIKMEEQCRDLNKRLEKETVQSKDFKLEVDKLSV
RITALEKLEDALDKSKQECYSLKCNLEKEKMTTKQLSEELESLNARIKELEAIESRLEKT
EITLKDDLTKLKTLTVMLVDERKTMSEKLKQTEDKLQSTTSQLQAEQNKVTTVTEKLIEE
TKRALKSKTDAEEKMYSVTKERDDLRNKLKAEEEKGHDLLSKVTILKNRLQSLEAIEKDF
VKNKLNQDSSKSTAALHQENNKIKELSQEVENLKLKLKDMKAIEDDLMKTEDEYETLERR
YANERDKAQFLSQELEHAKMELAKYKLAEKTESSHEQWLFRRLQEEEAKSGHLSREVDAL
KEKIHEYMATEDLICHLQGDHSLLQKKLNQQENRNRDLGREIENLTKELERYRHFSKSLR
PSLNERRISDPQVFSKEVQTEAADSEPPDYKSLIPLERAVINGQFYEENEDQDDDPNEEE
SVLSFRCSQSSSLPMNRKLWIPWMKSKEGHPQNGKIQTKSNGNFVQPGDLVLSHTPGQPL
HIKVTPDHIQNTATLEITSPTTESPHSYTSTAVIPNCGTPKQRITILQNASITPIKSKSS
TESLMNLEQSMSPVTMATFARAQTPESCGSVTPERTMSPIQVLAMTGSPSSPEQGCSPEP
IEISAKHAIFRVSPDRQSSWQFQRSNSNSSSVITTEDNKIHIHLGSPYMQAVAGPMRPAS
PSAPLQDNRTQGLTNGALNKTTNKVTSSITITPTATPLPRQSQITVSNIYN
NT seq 3396 nt   +upstreamnt  +downstreamnt
atgcgttccagaagcagcaatgctgagggctcagccccaaagcaaatcccaagacatagc
aaattccaggacagtatccaggacatgaagcacagaacacacaaaaaagacccctcgtgt
gagtcagaaggggtccttccacgtcccgtgtcagagaagtcacacactggcaaaggccac
cacacagaagacctctcaagagatgacttactatttctgctcagcattctggagggagaa
ctgcaggctcgagatgaagtcattggcattttaagggctgaaaaaatagacctggctttg
ctggaggctcagtatgggtttgtcactccgaaaaaggtgttggaggctctccagagagat
gcttttcaagcaaaatctgccccgtggcaggaggacatctatgagaaaccaatgaatgag
ttggataaagtcgtagaaaagcataaagaatctcacaggcggatcttggaacaactctta
atggtagaaagatcccaccggcaaaccataatggagatggaggaagaaaagagaaaacac
aaagaatatatgaagaagagtgatgaattcataaacttattggagcaggaatgtgagaga
ttaaagaaactaattgatcaagaaactgcgtcccaggaaaagaaggagcaagaaaaggag
aagaggatcaagaccctgaaggaggagctgaccaagctgaagtcctttgctttgatggtg
gtggatgaacaacaacggcttacagctcaactcgcccttcaaagacagaaaatccaagct
ctgaccacaagtgcaaaggaaacacagggtaaactagcccttgctgaggccagagctcag
gaagaagagcagaaggcaaccagactagaaaaagaactgcagacacagaccacagagttt
caccaaaaccaagacaaaattatggcgaagctcaccaatgaggacagtcaaaatcgccag
ctccgacagaagctggcagcactcagtcggcaaattgatgagttagaagagaccaacagg
tctttaagaaaagccgaggaagagctgcaggatataaaagacaaaataaacaagggagaa
tatggaaactctggcatcatggatgaagtggatgagctcaggaagcgcgtgctggacatg
gaagggaaagatgaagagctcataaaaatggaggagcagtgcagagacctcaataagagg
ctagagaaagagacagtacagagtaaagacttcaaactagaggttgacaaacttagtgta
aggatcacagctctggaaaaattagaagatgctttagacaaaagcaaacaagaatgctac
tctctgaaatgcaatttagaaaaagaaaagatgaccacaaagcaattgtctgaagagctg
gagagtttaaatgccagaatcaaagagctagaagccattgaaagtcggctagaaaagaca
gaaatcacactaaaggatgatttaactaaactgaaaactttaactgtgatgcttgtagat
gaacgcaaaacaatgagtgaaaaattaaagcaaacagaagataagttacaaagcaccacc
tctcagctccaagcagagcaaaataaagtaacaacagtgactgagaagttaattgaggaa
accaagagggcactcaagtccaaaactgatgcagaagagaagatgtacagtgtaaccaag
gagagagatgacctcagaaataaactgaaagcagaagaagagaaaggacatgatctcttg
tcaaaagttactatattgaaaaacaggcttcagtcactggaagcaattgagaaagatttt
gtaaaaaacaaattaaaccaagactccagtaagtccacagcagcattacaccaagaaaac
aataagattaaagagctctctcaagaagtggaaaatctgaaactgaagctaaaggatatg
aaagccattgaggatgacctcatgaaaacagaggatgagtacgagaccttagaacggagg
tatgctaacgagagagacaaggctcagtttctgtctcaggagctggaacatgccaagatg
gagcttgccaagtacaagttggccgagaagacagagtccagccacgagcagtggctcttt
aggaggctccaggaagaagaagcaaaatcagggcacctgtccagagaagtggatgcatta
aaagagaaaattcatgagtacatggccacagaggacctaatatgtcacctccaaggagac
cactcccttctgcaaaagaaactaaaccaacaagaaaacaggaacagagatttgggaaga
gagattgaaaacctcactaaagagttagaaaggtataggcactttagtaagagcctccgg
cctagtctcaacgaaagaagaatctctgacccgcaagtattttctaaagaagttcaaacg
gaagcagcagacagtgagccaccagactacaagagcctcattcctctggaaagagcagtg
atcaatggtcagttctatgaggagaatgaggaccaggatgacgaccctaatgaggaggag
tctgtgctgtccttcagatgcagccagtcttcttctcttcctatgaacaggaaactatgg
attccctggatgaaatccaaggagggccatcctcagaatggaaaaatacaaactaagtcc
aatggcaactttgtacaacctggagatcttgttctaagtcacacacctgggcagccactt
cacataaaggttactccagaccacattcaaaatacagctactcttgaaatcacaagtcca
accacagagagtcctcactcctacaccagcacagcggtgataccaaactgtggcacccca
aagcaaaggattaccattctccaaaatgcctctataacaccaattaagtccaaaagctct
acagaaagccttatgaacttagagcaaagcatgtccccagttaccatggcaacctttgcc
agagcacagaccccagagtcctgtggttctgtgactccagaacggacaatgtcacctatt
caggttttggctatgactggttcacctagttctcctgagcaaggctgctccccagagccg
atagaaatcagcgccaagcatgcaattttcagagtctccccagaccggcagtcatcatgg
cagtttcaacgttcaaacagtaacagctcaagtgtgataactactgaggataataaaatc
cacattcacttaggaagtccttacatgcaagctgtggctggccccatgagacctgccagc
ccttcagcaccactgcaggataacagaactcaaggcttaactaatggggcactaaacaaa
acaaccaataaagtcaccagcagtattactatcacaccaacagccacacctcttcctcga
caatcacaaattacagtaagtaatatatataactga

DBGET integrated database retrieval system