KEGG   Mus musculus (mouse): 78755
Entry
78755             CDS       T01002                                 

Symbol
Fam122b, 4632404H22Rik, AI256344, Pabir2, SPACIA2
Name
(RefSeq) family with sequence similarity 122, member B
Organism
mmu  Mus musculus (mouse)
SSDB
Other DBs
NCBI-GeneID: 78755
NCBI-ProteinID: NP_001159837
MGI: 1926005
Ensembl: ENSMUSG00000036022
Vega: OTTMUSG00000017350
UniProt: Q6NZE7 G1UD78
Position
X; X A5
AA seq 255 aa
MAQEKMDLDFEADTSEGATLRRSNSAPLIHVLSDLSQVFEPYPLRTGRTSTAIMSHHSLE
EGLDMMNRETTNEREAQAGMQISQSWDESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSP
TRGFGKQCLSPSLQMFVSSSGMPPSPVLNPRHFSRRSQSPVKCIRPSVLGPLKRKGEMEM
ESQPKRPFQGTTSMLSTNPAQLSDFSSCSDILDGSSISSGLSSDSLATGSAPAESPVACS
NSCSPFILMDDLSPK
NT seq 768 nt   +upstreamnt  +downstreamnt
atggctcaggagaaaatggatctggattttgaggctgacacatctgagggggccaccctg
agacggtccaacagtgctcccctgatccatgtgctcagtgacctttcacaggtttttgag
ccatatccacttagaactgggaggaccagtacggcaattatgagccatcatagcttggaa
gaaggcctggatatgatgaacagagaaactacaaatgaaagggaagcacaagcagggatg
cagataagccagtcatgggacgaaagcctgagcctgagtgatagtgattttgacaagcca
gagaaattatattctcccaaaagaattgacttcactccagtttctccagctccttcccca
accagaggatttggaaagcaatgcttgtcgccatccttgcaaatgtttgtgagcagcagc
gggatgccaccgagtcctgttctcaatccaagacatttttcaaggaggagccagagcccg
gtcaagtgcattaggcccagtgttcttggtcctcttaagagaaaaggggaaatggagatg
gaaagccagcctaagagacccttccaaggcaccaccagcatgctgtctaccaatcctgca
caattgtctgatttcagttcatgttcagatattttggatggcagtagtatcagcagtggc
ttgtcctcagactcactggctacaggcagcgctcccgcagagtctccagtagcatgctcc
aattcatgctctccgttcatcttgatggatgatctctcacccaagtga

DBGET integrated database retrieval system