KEGG   Mus musculus (house mouse): 78777
Entry
78777             CDS       T01002                                 
Symbol
Tepsin, 2410002I01Rik, Enthd2
Name
(RefSeq) TEPSIN, adaptor related protein complex 4 accessory protein
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: ENTH
Other DBs
NCBI-GeneID: 78777
NCBI-ProteinID: NP_898960
MGI: 1926027
Ensembl: ENSMUSG00000025377
UniProt: Q3U3N6 B2RPS6
Position
11:complement(119981348..119989675)
AA seq 573 aa
MAAVPPLRDRLSFLHRLPILLKGTSDDSIPCPGYLFEEIAKISHESLGSSQCLLEYLLNR
LDSSSGHVKLKVLKILLYLCGHGSSSFLLILRRNSALIQEATAFSGPPDPLHGNSLYQKV
RAAAQDLGSTLFSDAVPQPPSQPPQIPPPAGMGAQARPLSALQGFGYTKESSRTGSAGET
FLSTIQRAAEVVANAVRPGPDNPCTKGPLPYGDSYQPAVTPSASHTHPNPGNLLPGAILG
ARAVRHQPGQAGGGWDELDSSPSSQNSSCTSNLSRASDSGSRSGSDSHSGTSREPGDLAE
RAEATPPNDCQQELNLVRTVTQGPRVFLSREETQHFIKECGLLNCEAVLELLLRQLVGTS
ECEQMRALCAIASFGSADLLPQEHVLLLCRQQLQELGAGSPGPVTNKATKILRHFEASCG
QQLPTLRLCAQPNSAAAPVGPADLLTSPVPAPGSQVFLQPLSSATVVPRSPVLFPSPNTL
PPSALEEPSEVRTQLVCSSEQGTESEQRLENTDTPEDSSSPLPWSPNSLFAGMELVACPR
LPCHSSQDLQTDLQKVTTEAPVSEPSAFAFLNM
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggcagctgtgccgcccctgcgggaccgcttgagcttcttgcataggctccccatcctg
ttgaaggggacctcagatgatagcatcccatgtccaggctacctgtttgaagagatcgcc
aagatttcccacgagtcactaggcagcagccagtgcctgctggagtacctcctgaaccgt
ctggacagcagctccggccacgtgaagctcaaggtgctaaagatcttgctttacctgtgt
ggtcatggctcttcctccttcctcctcatcctcaggagaaactctgctctcatccaagaa
gccacggctttctcagggcctccagatcctcttcacggaaatagcttgtaccagaaggtg
cgggcggctgcccaggacctgggtagcaccctgttctcagatgccgtgccacagcctcca
tcgcagccacctcagatcccgcctcccgcaggcatgggcgcccaggccagacctcttagt
gccctgcaaggcttcggctacacgaaggagagcagccggacaggctccgcaggtgaaacc
ttcctctccaccatccagagggccgcagaggtagtggctaatgctgtgcgtcctggacct
gataatccttgtaccaagggacccttgccgtatggtgattcctaccagcctgcagtgaca
ccttcagctagccacacacatcccaaccctgggaatctactccctggggccatcctgggg
gccagagctgtgagacaccagcccgggcaggctgggggcggctgggatgagctggacagc
agtcctagttcccagaattcctcctgcaccagcaacctgagcagggcctcggactcgggc
agtcggtctggcagtgacagccactctggcaccagccgggagccaggcgacctggcagaa
agggctgaggccacgcccccaaatgactgccagcaagaactgaatctagtgaggactgtg
acacaggggccacgtgtcttcctgagccgtgaggagacgcagcacttcatcaaagagtgt
ggcctgctcaactgtgaggcagtgctggagctgctcctgcgccagctggtcgggaccagt
gagtgcgagcagatgagggcgctgtgtgccatcgcgtcctttgggagtgctgacctcctg
cctcaggagcacgtcctcctcctgtgccgacagcagctgcaggaacttggcgcgggcagc
cctggacctgtgaccaacaaagccaccaagatcctgagacattttgaagcctcctgtgga
caacagctccctaccctaaggctctgtgcccagcccaactctgcagctgcccctgtgggc
ccagctgacctgctgaccagccccgtgcctgcccctgggagccaggtcttcctccagcct
ctcagctccgccacagtggtacccaggagtcctgtgctctttccatcccccaatacctta
cctccgtctgctctggaggagcccagcgaggtccgaacccaattggtgtgttctagtgaa
caggggacagaatctgagcagaggctggagaacacagacaccccagaggatagctccagt
ccgctcccgtggagtcccaactctttgtttgctggcatggagctggtggcttgcccccgc
ctgccttgccacagctcgcaggacctccagacagatttacagaaggtgaccacagaagct
ccggtttcagagccatcagcttttgcatttttaaacatgtga

DBGET integrated database retrieval system