KEGG   Mus musculus (mouse): 78784
Entry
78784             CDS       T01002                                 

Symbol
Celf3, 4930415M08Rik, BRUNOL1, CAGH4, ERDA4, ETR-1, Tnrc4
Name
(RefSeq) CUGBP, Elav-like family member 3
  KO
K13207  CUG-BP- and ETR3-like factor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    78784 (Celf3)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    78784 (Celf3)
SSDB
Motif
Pfam: RRM_1 RRM_7 RNA_bind Nup35_RRM TFIIA
Other DBs
NCBI-GeneID: 78784
NCBI-ProteinID: NP_766022
MGI: 1926034
Ensembl: ENSMUSG00000028137
Vega: OTTMUSG00000052184
UniProt: Q8CIN6
Position
3:94385581..94405822
AA seq 465 aa
MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDS
ALKAQSALHEQKTLPGMNRPIQVKPADSESRGDRKLFVGMLGKQQTDEDVRKMFEPFGTI
DECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGL
RRMQQVATQLGMFSPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMA
AISANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDALYPN
GVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQ
QQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQS
KCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDANRPY
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaaggagccagatgccatcaagctgtttgtggggcagatcccgaggcatctggaggaa
aaggacctgaagcccatcttcgagcagtttggtcggatcttcgagctgactgtcatcaag
gacaagtacaccgggctgcacaagggatgtgctttcctgacgtactgtgctcgcgattca
gccctgaaggcccagagtgccctgcacgaacagaagactctcccagggatgaacaggccg
atccaggtcaagccagccgacagcgagagtcgaggagaccggaagctctttgtgggcatg
ctaggaaagcagcagacagatgaggatgtccggaagatgtttgaaccatttgggactata
gacgagtgcactgtgctccgggggccagacggtaccagcaaaggctgtgcctttgtgaag
ttccagactcacgctgaggcccaggcagccatcaacacccttcacagcagccggacccta
ccgggtgcctcatccagcctggtggtaaagtttgctgacacggagaaggagcgaggtctc
cgtcgaatgcagcaggtggctacccagctgggcatgttcagcccgatcgccctccagttt
ggagcctacagcgcctacacccaggccctgatgcagcagcaggcggccctggtagcagct
cacagtgcctacctcagccctatggccaccatggctgccgtgcagatgcagcacatggct
gccatcagtgccaatggcctcatcgccacccccatcactccatcctcaggaaccagcacc
cctcctgccattgctgccacgcccgtctctgccatccctgctgccttgggcgtcaacggc
tacagcccggtgcccacccagcctacagggcagcctgccccggatgctctgtatcccaac
ggggttcacccttacccagcccagagcccggcagcccccgtggaccctctccagcaggcc
tatgcaggaatgcagcactacacagcagcgtaccccgcagcctacagcctggttgcacct
gcgttcccgcagcctccagccctggttgcccagcagcccccaccaccacctcagcaacag
cagcagcagcagcagcagcaacagcaacagcagcagcaacgggaaggccctgatggctgc
aacatcttcatctaccacctgccccaggagttcacagactcagagatcctccagatgttt
gtcccttttggtcatgtcatctcagccaaagtctttgttgaccgggccaccaatcagagc
aaatgttttggctttgtgagtttcgacaatccggccagtgcccaggctgccatccaggct
atgaacggtttccagattggcatgaagcgcctcaaagtccagctaaagcggcctaaggat
gcaaacaggccctactaa

DBGET integrated database retrieval system