KEGG   Mus musculus (house mouse): 78787
Entry
78787             CDS       T01002                                 
Symbol
Usp54, 4930429G18Rik, AI115571, C030002J06Rik
Name
(RefSeq) ubiquitin specific peptidase 54
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: UCH UCH_1 EPO_TPO
Other DBs
NCBI-GeneID: 78787
NCBI-ProteinID: NP_084456
MGI: 1926037
Ensembl: ENSMUSG00000034235
UniProt: Q8BL06
Position
14:complement(20598980..20694559)
AA seq 1588 aa
MSWKRNYFSGSRGSVQGMFAPRSSMSIAPSKGLSNEPGQNSCFLNSALQVLWHLDIFRRS
FRQLTTHKCMGDSCIFCALKGIFNQFQCSSEKVLPSDTLRSALAKTFQDEQRFQLGIMDD
AAECFENLLMRIHFHIADETKEDICTAQHCISHQKFAMTLFEQCVCSSCGATSDPLPFIQ
MVHYISTTALCNQAICMLEKREKPSPSMFGELLQNASTMGDLRNCPSNCGERIRIRRVLM
NAPQIITIGLVWDSEHSDLAEDVIHSLGTCLKLGDLFFRVTDDRAKQSELYLVGMICYYG
KHYSTFFFQTKIRKWMYFDDAHVKEIGPKWKDVVTKCIKGHYQPLLLLYADPQGTPVSAQ
DLPPHAQFLPYTKTCYDSEDSGHLTDSECNQKHTSKKGSLVERRRSSGRVRRKGDEPQAS
GYHSEGETLKEKQAPRNASKSSSSSRLKDFKETVSNMIHSRPSLASQTSAGSPCVGRAGD
QLDKIPPRNFPLQARGWETESTSSEAKSSSSSKYRPTWRPKRESLNIDSIFSKDRRKHCG
YTQLRTFPEDAAKEFTPDEVSKPTANDIKDGGSRSQHKLWGTARPGSHLLEQHPRLIQRM
ESGYESSERNSSSPVSLDAAPPDSVNVYRDQSTKRPVGFVPSWRHIPKSHSSSILEVDCT
APMTSWTKTQPLSDGEVTSRSELDELQEEVVRRAQEQELRKKREKELEAAKGFNPHPSRY
MDLDELQNQGRSDGFERSLQEANSIFEESLHLEQKGDCAAALALCNEAISKLRLTLHDAS
SSTHSRALVDKKLQISIRKARSLQDRMQQQASSQQPVQPSASLPSQGGALPQPTSEQPIT
LQVLLNQEAQLEPCKDTELGATSSFFHSPASCPELHSSLIPESPVSSVSQHSPPGTSSLK
LLTSFEVDSVNRSAFHRQGLPKATGRTEMNSQHECLPLDALEDRLQGHREDNSCCSKFPP
REGRDIAQDQLFEGKKNPADISMGMPWSYSTGEATSERVIYSLNSPSSSSAQPSIPPYSS
CHPITSAASSPVLHAADPMQKLNQHVQAQSLQTSLTSKVVRSSEEPYRLEFPSTKGLVRS
LAEQFQKMQNTSTRDVIGSQDRSLPNGVRKSSSPSDFMPPLSQGPGREHCRWVKQPRSPD
GRERPPCWEDPAAHPPLSMGSGLPDGETSRTAQPRLAEPDMYQGKLPQVTDIRSKELGSS
VNLGTSLPLDSWVNVTRLCDSQVKPSAPGPGDKSSSHDSHPRATCLERSPILLHPHWDQD
TEQETSELESLYQASLQASSHTAYSDWRSQDVAWQPLSLAGSADGMGRRLHSAPGLDLSK
PLTAEMEHVLYEPSTVPVSQDSSNVRKKTLETGHHCSSSSSLPVIHDPPVFLLDPKLYPP
QPQFLSPDVLMPSMAGEPYRPPGTSRSVHQFLAMCDRDETPQGVKYTGRTLNYRSLPHRS
RTDASWGPGSETNQHIGARVLTMPACKPQLTYTATLPERHQGLQVPHAQSWGNLFHSPSH
PSAVHPGSPPSSNLHVPLRSTWNSGPVLGSRTPGPRRIDMPPDDDWRQSSYPSQDRHRSP
GEERIMFALSNAAGREQNRVRFLQHSRW
NT seq 4767 nt   +upstreamnt  +downstreamnt
atgtcttggaaaagaaattacttttctggaagccgaggtagtgttcaagggatgttcgca
cctcggagctcaatgtccattgcccccagcaaaggcctcagcaatgagccagggcaaaac
agctgcttcctcaacagtgccctgcaggttttgtggcacttggacatcttccgccgtagc
tttcggcagcttacaactcacaagtgcatgggtgattcctgcatcttctgtgctctcaag
ggcatctttaaccagtttcagtgtagtagtgaaaaagtgcttccttccgacactctccgc
agtgctctggcaaagactttccaagatgaacaacgcttccagctggggattatggatgat
gctgcagaatgctttgaaaacctcctgatgagaattcacttccatattgctgatgaaacc
aaagaggatatatgtactgctcaacactgcatatcccaccagaaatttgcaatgacattg
tttgagcagtgtgtgtgcagcagctgtggcgccacgtccgacccgctgccctttatccag
atggtgcactacatctccaccactgccctctgtaaccaggctatttgtatgctggaaaag
cgagagaaaccctcaccaagtatgtttggtgagctgcttcagaatgccagcaccatgggg
gacctgcggaactgtccgagcaactgtggggagagaatccggatccgccgtgtcttgatg
aatgcaccacagattatcacgattggtctggtttgggactcagagcattcagacttggca
gaggacgtcatccacagcctgggcacctgccttaagctgggtgatctgtttttcagagtg
acagatgaccgggccaagcagtctgaactatacttagtaggaatgatctgttactatggc
aagcattattctacattcttttttcaaacaaagatccgcaaatggatgtattttgatgat
gctcatgtcaaggagattggtccgaagtggaaggatgtggtcaccaaatgcattaaaggg
cactatcaacccttgctgctgctctatgcagacccccagggtactccagtgtctgcccag
gacctgcctccccacgctcagttcctgccatacaccaagacatgctacgatagtgaagac
tcaggacacctgactgatagtgaatgtaatcagaaacacacatcgaagaaagggtccctg
gtggagcgcaggaggagcagtggccgtgttcggagaaaaggcgatgagccacaggcctca
gggtaccacagcgaaggagaaacactgaaagagaagcaggctcctaggaatgcctctaaa
tccagcagcagcagcaggctaaaggatttcaaagagacagtcagcaacatgatccacagc
aggccttccctggcttctcagaccagtgcaggatctccctgtgtaggtagggcaggagac
cagctagacaagataccaccaaggaacttccctttacaggctcggggctgggaaacggag
agtaccagtagtgaggcaaaatccagttcttccagcaagtaccgcccaacatggagacct
aaacgagaatctctaaatattgacagcatttttagtaaggacagaaggaagcattgtggc
tacacccagcttaggacctttcctgaagatgcagctaaagaatttacaccggatgaagta
agcaagccaactgctaatgacattaaagatggcggatcaaggtcacagcataaactctgg
ggaacagctcggccaggctctcatcttttagagcagcatcctcgcctaatccagcggatg
gaatctggctatgagagcagtgagaggaacagcagcagccctgtcagtttggatgctgcc
ccgcctgacagcgtgaatgtctacagggatcaaagcacaaagaggcctgttgggtttgtc
ccttcttggcgtcatattccaaagtctcacagcagtagcatcctggaggtagactgtaca
gcacccatgaccagctggacaaagactcaacctctctcagatggggaggtcacctctaga
agtgaattggatgaactacaggaagaagtggtcaggcgagcccaggaacaggagctgcgg
aagaaacgggagaaggaattagaggctgctaaaggctttaaccctcatcccagccgctac
atggatttggatgaactgcagaatcaggggaggagtgacggctttgaaaggtccttgcaa
gaggcaaattcaatatttgaagagtcgctgcatctggaacaaaagggagactgtgctgca
gctctggctctgtgtaacgaagctatctctaaactaagacttaccctgcatgatgccagc
tctagcacgcacagcagagccctagtcgataagaagttgcaaatcagtattcgaaaagca
cgaagccttcaggatcgcatgcagcaacaagcatcatcgcagcagccggtgcagccctca
gcctctctcccatcacaggggggcgccctccctcagccgacaagtgaacagcctatcacg
ctccaagtattgttaaaccaggaggcacagctggaaccttgcaaggatacagagcttggg
gccacttcctctttcttccactcacctgcttcctgccctgagttacactcatcactcatc
ccagagtcacctgtttcatctgtttcacagcacagtccccctgggacatcttccttgaag
cttctgacgtcttttgaggtggacagcgtcaatcgctctgcattccacaggcagggttta
cctaaagcaacaggtagaactgagatgaactctcaacatgaatgcctgccattagatgcc
cttgaagataggctccaaggccacagggaggacaacagctgttgcagcaaattcccacca
cgagaaggaagagacatagctcaagatcagctgtttgaaggaaaaaagaatcctgctgat
atatccatggggatgccttggtcatattcaacaggagaagccacttctgagagagttata
tatagcctaaatagtccttcaagttcatcagctcagcctagtattcccccttacagttcc
tgccaccccatcacgtctgctgcttcttcacctgtgcttcatgctgctgaccccatgcag
aaacttaaccaacacgttcaagcccaaagtctccagacttcattgacttcaaaagtggtc
agaagcagtgaggagccctataggctagagttccccagtacaaaaggacttgtccgctca
ttggcagagcaattccagaagatgcagaatacttccacgagagatgttataggttcccag
gatagaagtttgccaaatggtgtcaggaagagctcttctccttctgactttatgcctcca
ttatcccagggtccaggaagagagcactgtcgctgggtaaaacaaccccgttcccccgat
ggcagggaaagaccgccctgctgggaagaccctgcagctcatcctcctctttccatgggc
tcggggcttcctgatggtgaaacctcgaggacagcacagcccaggctggctgagccagat
atgtaccaaggaaagctaccccaagtgacagatattaggtccaaggagctgggtagtagt
gtcaatttggggacttctttgcctttggattcttgggtaaatgtcacaaggctctgtgat
tctcaggttaaacccagtgcccctgggcccggagacaagtcctcctcccatgattcccac
ccacgtgcaacctgcctagaaagaagtcctatccttttgcatccacactgggaccaagac
acagagcaggagacctctgaactggagtctctctaccaagccagccttcaggcctcttct
cacactgcctattctgattggagatcacaggatgtggcctggcagccacttagcctagca
ggctctgcagatggcatgggaaggagactgcactcagcccctgggcttgatctctcaaag
cctctgacagcagagatggagcatgtcctttatgaaccgagcacagtgcctgtctctcag
gattcatcaaacgtgaggaaaaagactttggaaaccgggcaccattgttccagctcctct
tccctccctgtcatccatgatcctcctgtatttctccttgatcctaaactctaccctccc
caaccacagttcctgtccccagatgtcctgatgcccagcatggcaggggagccctataga
cccccaggaacttcaaggagtgtccaccagtttctggctatgtgtgacagggatgaaact
ccccaaggggtcaagtacacaggaaggactttgaactaccgaagtctacctcatcgttcc
agaactgatgcttcctggggaccagggtcagagaccaaccagcacattggggccagagtc
ctaactatgccagcatgcaagcctcagctaacctacactgccacactaccagaaagacac
cagggccttcaggttccacatgctcagtcctgggggaatcttttccactcaccctcccat
ccttctgctgttcacccagggtccccaccatccagcaatcttcatgtaccccttaggtca
acttggaattctggtcctgttctggggtcccgaacacctggtccacgaagaatagacatg
cccccagatgatgactggagacagagcagttacccctcccaggacagacacaggagccca
ggagaggaaagaattatgtttgctctatcaaatgctgctggaagagagcagaacagggtg
agatttctacagcacagcaggtggtaa

DBGET integrated database retrieval system