KEGG   Mus musculus (house mouse): 78789
Entry
78789             CDS       T01002                                 
Symbol
Vsig1, 1700062D20Rik, 4930405J24Rik
Name
(RefSeq) V-set and immunoglobulin domain containing 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 V-set ig Trypan_PARP Rick_17kDa_Anti Gly-zipper_Omp Gly-zipper_YMGG DUF2613 Syndecan
Other DBs
NCBI-GeneID: 78789
NCBI-ProteinID: NP_080379
MGI: 1926039
Ensembl: ENSMUSG00000031430
UniProt: Q9D2J4
Position
X:139808357..139840221
AA seq 300 aa
MQPADSGIYICDVNNPPDFVGKNQGLLDVTVLVKPSKPFCTIQGRPEAGHPISLSCLSAF
GTPSPLYYWYKIEGNTIVPVKESFNTATGVLVIGNLTNFEQGYYQCTAINSLGNSSCEID
LTSSHPEVGIIIGALVGALIGAAVIICVVYFARNKVKSKQQKNLNSSTELEPMTKVHHPQ
QSEAISADGVQLEGTLPSSIHAGHNTEPTTTAVLEPEYEPNPPLETTTQPDPEPEGSVPV
LAPEAEIQPHPELDPETETEPEPEPEPKPEPEPEPELEPDPQSGVIIEPLSKAGEDTVKA
NT seq 903 nt   +upstreamnt  +downstreamnt
atgcagccagcagacagtggaatttacatctgtgatgtcaacaatcctccagattttgtg
ggcaaaaaccaaggcctccttgacgtcactgtcttagtcaaaccttccaagcccttttgt
accatccaaggaagaccagaagcaggccatcctatttccttgtcttgcctttctgccttt
ggaacaccgtctcctttgtattactggtataagattgaggggaacaccattgtgccagta
aaagaaagtttcaacacggccactggagttttagttattggaaatctaacaaattttgaa
caaggttattaccagtgtactgccatcaacagtcttggcaatagttcctgtgaaattgac
ttaacgtcttcacatccagaagttgggatcatcatcggagctttggtcggtgccctgata
ggagctgctgttatcatctgtgtggtgtactttgccaggaacaaagttaaatccaagcag
cagaagaatttaaattccagcacagaacttgagccaatgacaaaggtacaccatccccaa
caaagtgaggcaatttcagctgatggcgtccagctagaaggaactctgccatcttccatc
catgctggccacaacaccgaacctactactacagcagtcttggagccagaatatgagcct
aatcctccactggaaactaccacacagcctgaccctgaaccagagggttcagtgccagtg
ctagcacctgaggcagagattcaaccacacccagagctggacccggagactgagacagag
cctgagcctgagcctgagcctaagcctgagcctgagccggaacctgagcttgagcctgat
ccccagtctggagtaataattgagcctctgagcaaggcgggagaggatacagttaaggca
taa

DBGET integrated database retrieval system