KEGG   Mus musculus (mouse): 78803Help
Entry
78803             CDS       T01002                                 

Gene name
Fbxo43, 4930533G20Rik, Emi2
Definition
(RefSeq) F-box protein 43
  KO
K10318  F-box protein 43
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    78803 (Fbxo43)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    78803 (Fbxo43)
   03036 Chromosome and associated proteins [BR:mmu03036]
    78803 (Fbxo43)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     78803 (Fbxo43)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Early mitotic inhibitors
    78803 (Fbxo43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IBR F-box-like F-box
Motif
Other DBs
NCBI-GeneID: 78803
NCBI-ProteinID: NP_001074722
MGI: 1926053
Ensembl: ENSMUSG00000048230
UniProt: G3X9B2
Structure
PDB: 

Position
15; 15 B3.1
AA seq 641 aa AA seqDB search
MDSSAVTVKGLSLIDFCSTSSFKYRGHHELSESCSLNKKEEEPMLTCEHPETPSLGSPNS
AVSPSQIMKSVSLRKEKDKSPELCETPKLRRKKCTLRRRLDFSFPLLKGDSDSQSRSLES
NISQGVSLEKHLPGSTSGFPKEDNFSPLVTSTIKTEDVVSNSQNSRLHFSQHKTSTIEDS
KDNCGLFEVECLSPIEGNDFKDSITHFSDSSLSVSDENTCPELLGSCGSQTTYGADVTTS
VTPVSSLIAKIKFNGNQTLDSSGEVRDSLFTPEDSGFCSLSWDKSEDFLSDQEGSFQELL
QKHRVTPKVGDQVKKPKHFGRLRRLSTLQEQGSQSEDEMQTVHPNSDSGVLESLQGSEEK
RGNLALSFKDLSNTPALQLVQELFMKSKRKRSQQEDDQEFFEDRDEGKIARLQRVLAGLI
GKKMGIEQLDILTELQYRNLKHILAMVLESLTSESLYSAWNVSRNWREIVAQDKKANRRR
KLYIIQLRASAQGAAVLRVQDAATRLCLLSRLALRSVQAQAQAPSGEQVPTLSPWGDVLT
PVASSSLTHLRSKQEQYVKVARTLFTDEALKPCPRCQSPAKYQPHKKRGLCSRLACGFDF
CVLCLCAYHGSEDCRRGSAKARGSKDVLPGSAQSKRNLKRL
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggactcctctgctgtcactgtcaagggtctcagcctcatagacttttgttccacatcc
tcctttaaatataggggccatcacgagctgtcagaatcttgcagccttaataagaaagaa
gaagagcctatgctaacctgtgagcatcctgaaactccaagtttaggttcccccaattct
gcagtatctcccagtcaaataatgaagtctgtgtccctaaggaaggaaaaggataaaagc
ccagaactttgtgagactcctaaactcagaaggaaaaaatgcacattacgcaggcggcta
gacttttctttccctcttctgaagggggattctgattcacaaagcagatctctggaaagt
aacataagccaaggtgttagcctagaaaaacatttgccaggtagcacttcaggtttccca
aaggaagacaactttagcccattagttaccagcacgataaaaacagaggatgtggtttcc
aacagtcagaactcaaggttacatttttctcagcacaagacttccaccattgaagattcc
aaagacaactgtggcttgtttgaagtggaatgtctgtctccaattgaaggcaatgatttt
aaagattctatcacacactttagtgacagcagtttaagtgttagtgatgagaatacatgt
cctgaacttctgggctcctgtggtagccaaacaacctatggagcagatgtgactacatct
gtaactccagtaagtagtctcatagcaaaaatcaaatttaatggaaaccaaactcttgat
tcttcaggagaggtgagagacagtctttttacacctgaagacagtggcttttgctcactt
agctgggacaaatcagaagatttcctctctgaccaagagggctcttttcaagaactgctt
caaaaacacagggtgactcccaaagttggggaccaggtaaaaaagccaaagcattttggg
aggttgagaagactgtccactctccaggagcaaggctcccagtcagaggatgaaatgcag
acggtccatcctaactctgattcaggtgtcttggagagtctgcaaggctctgaggagaag
cgtgggaacttggctttaagctttaaggacttatcaaatactccagccctgcagttggtg
caggagctctttatgaaaagcaaaaggaaacgatctcagcaggaagatgaccaggaattc
tttgaggacagggacgaggggaaaattgccagactgcagcgtgttctcgcaggactgatt
ggcaagaagatgggcatagaacagctggatatcctgaccgaattacagtatagaaacttg
aagcacatcctagctatggttttagagtccttgacttcggagagtttatacagtgcttgg
aacgtcagcagaaactggcgtgaaattgtggctcaggataaaaaggcaaacaggaggagg
aaactttatatcatacagctgagagcaagtgctcagggggccgctgtgttacgtgttcag
gatgctgccactcggctctgccttctgagtcgcttggccttaagatcagtgcaggcacag
gcacaggcacccagtggtgagcaggttccaactctgtccccttggggggatgttctgaca
cctgtagcaagctcttccctcacccacctacggagtaaacaggaacagtatgtgaaggtt
gccaggacactgtttactgatgaagctttaaagccttgcccgaggtgccaatcccctgct
aagtaccagccgcacaagaaaagggggctatgcagccgcctggcctgcggctttgacttc
tgtgtgttatgtctgtgcgcttatcacgggtctgaagactgtagaagagggtcagcaaag
gcgagaggtagcaaagatgttctcccagggagtgcccaaagcaagcggaacttaaaacgc
ctctga

DBGET integrated database retrieval system