KEGG   Mus musculus (mouse): 78816
Entry
78816             CDS       T01002                                 

Gene name
Gmip, 5031419I10Rik
Definition
(RefSeq) Gem-interacting protein
  KO
K20653  GEM interacting protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    78816 (Gmip)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    78816 (Gmip)
SSDB
Motif
Pfam: RhoGAP C1_1
Other DBs
NCBI-GeneID: 78816
NCBI-ProteinID: NP_932769
MGI: 1926066
Ensembl: ENSMUSG00000036246
Vega: OTTMUSG00000027254
UniProt: Q6PGG2
Position
8; 8 B3.3
AA seq 971 aa
MDSAETELTPAPEGRKRYSDIFQSLDNLEISLGNVTFDPLAGDPVRREDLEPDKADTATV
VTEENSEASSWRDLSPEGPAPLTEEELDLRLIRTKGGVDAALEYAKAWSRYAKELLAWTD
KRANYELEFAKSIMKLAEAGKVSILQQSQMPLQYIYTLFLEHDLSLGALALETVAQQKRD
YYQPLAAKRMEIEKWRKEFKEQWLKEQKRMNEAVQALRRSELQYIQRREDLRARSQGSPE
DPPSQASPGSNKQQERRRRSREEAQAKAHEAEALYQACVREANSRQQDLETTKRRIVSHV
RKLVLQGDEVLRRVTLGLFELRGAQAERGPRSFSALAECCVPFEPGQRYQEFVRTLQPGA
PPPPSPAFCFQEFTAVVHSFPQDTKKKFSGPLPPRLEEEGSPEPGPWEVASLGSQGIPGS
DVDSVGGGSESRSLDSPTSSPGAGARRLVKASSTGTESSDDFEERDPDLGDGIENGVGSP
FRKWTLSTAAQTHRLRRLRGPAKCRECEAFMVSGTECEECFLTCHKRCLETLLILCGHRR
LPARMSLFGVDFLQLPRDFPEEVPFVITRCTAEIEHRALGLQGIYRVSGSRVRVERLCQA
FENGRALVELSGNSPHDITSVLKRFLQELTDPVVPFHLYDAFISLAKTLHADPGDDPGTP
NPSPEIIRSLKTLLVQLPDSNYSTLRHLVAHLFRVAARFEENKMSANNLGIVFGPTLLRP
PDGPRATGASPVACLLDSGHQAQLVEFLIVHYEQIFGMDELPLASEPLTQDPGLAPACLE
SSPQHPASLLAQDTQPLTIALDSSPDPKHHSALEKCPEVTPPELATLQRDQREEEVEDTR
DGAGDGSSHCPEDLALGAQSRGHFSRQPVKYSRGGVRPVTHQLSSLALVASKLCEETPVT
VSAVHRGSLRVRGLGPAAACPEGSPLRRNPLPKHFEITQETARLLSKLNSDAVSRTTCCA
DPEPEESEEHL
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggactcagcggagacagagctaaccccagctcctgagggcaggaagagatacagtgac
atcttccagagcctggacaacctcgagatatcattggggaacgtaacttttgatcccctg
gctggagaccctgtacgcagagaagacctggagcctgacaaagctgacacagccacagtg
gtgactgaggagaacagtgaagccagtagttggcgggatctctccccagaaggtcctgca
cccctcacagaggaagaactggatttgcgactcattcggaccaagggtggtgtagatgct
gccctggagtatgctaaagcatggagccgctatgccaaggaactgctggcctggacagac
aagagagccaactacgagctcgagtttgctaagagtatcatgaagctcgctgaggctggc
aaggtgtccattctccagcagagccaaatgccactccagtacatctacaccttgtttctg
gagcatgacctcagcctgggagccctggccctggagacagtggcccaacagaagagagac
tactaccagcctctggcggccaaaaggatggaaattgagaagtggaggaaggaattcaag
gaacagtggctgaaggagcagaagcgcatgaatgaggcagtgcaggcactgcggcgctcc
gagctccagtacattcaacgcagagaggacctgagggcacgctcccaggggtcccctgag
gaccctccttcccaggcatctcctggatccaacaagcaacaggagcgcagacggcgctcc
cgagaggaggcacaggccaaggcgcatgaggcggaggctctgtaccaggcctgtgtccgg
gaggccaattctcgccagcaggatctggagaccaccaagcggcggatagtgtcacatgtg
cgcaagctggtgctgcaaggagacgaagtgcttaggcgggtgacgctgggtctgtttgag
ctgcgaggggcgcaggcagagcgaggaccccgctccttctctgctctggctgagtgctgt
gtgccctttgaacctggccagcgctaccaggagtttgttcggacactgcagcctggggcc
ccaccgccgccatctccggccttctgcttccaggagttcacagctgtggtgcacagtttc
cctcaggacacaaaaaagaagttttcggggcctctacctccaaggctggaggaggagggt
tcccctgagcctggcccttgggaggttgccagcttaggcagccagggaatcccaggcagt
gatgtggacagtgtaggtggtggcagtgagtcccggtctttggattctcccacttccagc
ccaggtgctggggcccgccgacttgtaaaggcttcgtccacaggcacggagtcctccgat
gactttgaggagcgagaccctgatctgggggatgggatagagaatggagtaggcagcccg
ttcaggaagtggacactgtccacagctgctcaaacccaccgactgcggcggctgcggggc
ccagccaagtgcagagaatgtgaagccttcatggtcagcgggacagaatgtgaagagtgc
tttttgacctgtcacaagcgctgcctggagaccctcctcatcctttgtggacaccggcgg
cttccggcccggatgtccctctttggggttgacttcctacagctccccagagatttccct
gaggaggttccctttgtgattaccagatgcacagctgagatagagcaccgtgccctgggc
ttgcagggtatctatcgggtcagcgggtctcgggtacgtgtggagcggctgtgccaggcc
tttgagaatggccgagcactggtcgagctgtccgggaactctcctcacgatatcaccagc
gttctcaagcgatttcttcaggagctcactgatcccgtggtccccttccacttgtacgac
gccttcatctctctggcaaagaccctgcatgcagaccctggggacgaccctgggaccccc
aaccccagccctgagattattcgctcgctgaagaccctcttggtgcagctgcctgactct
aactacagtaccctgcgacacctggtggcccatctgttcagggtggctgctcggtttgaa
gaaaacaagatgtctgccaacaatctgggaattgtatttgggcctacactgctgcggcca
ccagatggacccagggccaccggtgccagccctgtggcctgtctgctggactccggtcac
caggctcagctggttgagttcctcattgtgcactatgagcagatctttggaatggatgag
ctccctctggcctcggagcctctgacccaagaccctggcttggctcctgcatgccttgaa
tccagtccccagcacccagcctcacttcttgcccaagacacacagcccctgaccatagcc
ttggattccagcccagaccccaaacaccacagtgccttggagaagtgccccgaggtcaca
cctcctgagcttgcaactctgcagagggaccagagggaggaggaggtggaagacaccaga
gatggggcaggggatgggtccagccactgccctgaggacttggccctgggagcacaatcc
cggggccacttcagccgccagccagtgaagtattcccggggaggtgtgaggccagttact
catcaactctccagcctggctctggtggcctccaagctgtgtgaggagactcctgtcact
gtctcagcagtgcaccgaggtagtttgagggtacgaggtttgggccctgctgctgcctgc
cctgaaggcagccccctgcgccggaaccctctgcccaagcactttgagatcacccaggag
acagcccgacttctctccaagctgaacagtgatgctgtgtccaggaccacctgttgtgct
gacccagagcctgaggagtctgaagagcacctctga

DBGET integrated database retrieval system