KEGG   Mus musculus (mouse): 78826
Entry
78826             CDS       T01002                                 

Symbol
P2ry10, 5830408N17Rik, Lypsr2, P2Y1, P2Y10
Name
(RefSeq) purinergic receptor P2Y, G-protein coupled 10
  KO
K04274  P2Y purinoceptor 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    78826 (P2ry10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    78826 (P2ry10)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidylserine
    78826 (P2ry10)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 78826
NCBI-ProteinID: NP_766023
MGI: 1926076
Ensembl: ENSMUSG00000050921
Vega: OTTMUSG00000018160
UniProt: Q8BFU7
Position
X; X D
AA seq 328 aa
MGSNSTSSAESNCNATYLPFQYSLYATTYIFIFIPGLLANSAALWVLCRFISKKNKAIIF
MINLSVADLAHILSLPLRIYYYINRHWPFQRALCLLCFYLKYLNMYASIFFLTCISLQRC
LFLLKPFRARNWKRRYDVGISAVIWIVVGTACLPFPILRNAGLANSTDSCFADLGYKQMD
AVVLVTMVVIAELAGFVIPVITIACCTWKTTVSLKHPPIAFQGISERKKALRMVFMCAAV
FVICFTPYHINFIFYTMVKESIITSCPTVKSTLYFHPFSLCLASLCCLLDPILYYFMASE
FRDQLSRHGSSVTRSRLMSRESGSSMVN
NT seq 987 nt   +upstreamnt  +downstreamnt
atgggcagcaacagtaccagcagtgctgagagcaattgcaatgccacttatttgccattt
cagtactctctgtatgcaactacctatatcttcatattcatcccgggtctcctggctaac
agtgcagccctgtgggttctgtgccgcttcatcagcaagaagaacaaggccatcattttc
atgatcaacctctcagtggcagaccttgctcatatcctgtccttacctcttcggatttac
tattatatcaatcgtcactggccattccagagggccctttgcctgctgtgtttctatctg
aaatatctcaacatgtatgccagcatttttttcttgacatgcattagccttcagaggtgc
ctctttctcctcaaaccattcagagccagaaactggaagcgtaggtacgatgtgggcatc
agtgctgtcatctggattgttgtagggactgcctgtttgccatttcccatcctgagaaat
gctggcttagccaatagcacagattcttgctttgctgatcttgggtacaaacagatggat
gcagtggttctggtcaccatggttgtaattgctgaacttgctggatttgtgattccagtg
atcaccattgcatgttgtacctggaaaacaactgtatccttgaaacacccaccaattgct
tttcaagggattagtgagaggaaaaaagcattgcggatggttttcatgtgtgctgcagtc
ttcgttatctgcttcactccttatcacattaacttcattttttacaccatggtaaaggaa
agcatcattaccagttgtcccactgtaaaaagtaccctgtatttccatcctttttcccta
tgccttgcaagtctctgttgtcttttggacccaattctgtactatttcatggcttcagag
tttcgtgaccaactatctcgtcatggaagctctgttactcgttctcgtctcatgagcagg
gagagtggatcatcaatggttaactaa

DBGET integrated database retrieval system