KEGG   Mus musculus (mouse): 78829
Entry
78829             CDS       T01002                                 

Symbol
Tsc22d4, 0610009M14Rik, 1700023B23Rik, AI415410, Thg-1pit, Tilz2
Name
(RefSeq) TSC22 domain family, member 4
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: TSC22 K-box YabA ZapB DivIC DUF6262
Other DBs
NCBI-GeneID: 78829
NCBI-ProteinID: NP_076399
MGI: 1926079
Ensembl: ENSMUSG00000029723
Vega: OTTMUSG00000022818
UniProt: Q9EQN3
Position
5:137744231..137766715
AA seq 387 aa
MSGGKKKSSFQITSVTTDYEGPGSPGASDSPVPPALAGPPPRLPNGDPNPDPGGRGTPRN
GSPPPGAPASRFRVVKLPQGLGEPYRRGRWTCVDVYERDLEPPSFGRLLEGIRGASGGTG
GRSLDSRLELASLGISTPIPQPGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLAGPGKAK
VETPPLSASPPQQRPPGPGTGDSAQTLPSLRVEVESGGSAAATPPLSRRRDGAVRLRMEL
VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSMLAISGHLDSDD
DSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRDLAERNAALEQENGLLRAL
ASPEQLAQLPSSGLPRLGPSAPNGPSI
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgagtggtggtaagaagaaaagtagttttcagatcaccagcgtcaccacggactatgag
ggcccaggaagcccaggggcttcggattcccctgtcccaccggctctcgctgggcccccg
ccccgcctccccaatggggaccccaaccctgatccagggggcaggggcaccccccggaat
ggctctccgccacctggagcccctgcctcccgtttccgggtggtgaagctgccccaaggt
ttgggagagccttatcgtcgaggtcggtggacgtgtgtggatgtttacgagagagatctg
gagcctccaagcttcggtcggcttctggagggcattcgaggggcctctggaggcaccgga
ggcagatcattggattctaggttggagctggctagtttgggcataagcacccctatcccg
cagccaggcctgtctcagggccccacctcttggctccgcccgccccctacttctcctgga
ccacaggcccgctccttcacaggggggctgggccagctggcaggacctggcaaggctaag
gtggagacacccccgctgtcagcatctccaccccagcagcgccccccagggcctgggact
ggagatagtgctcagaccctgccctctctgagggtagaagtggagtctgggggttcagca
gccgcaacccctccactgtcacggagaagagatggagcagttcggctgaggatggagtta
gttgctccagcggagacaggaaaggtacctcccaccgactctcgccccaactccccagcc
ctctacttcgatgccagcctggtccataagtctccagacccatttggagccgcagcagcc
cagagcctcagcctggcccgttccatgttggctatcagcggtcacctggacagcgatgac
gatagtggttccggaagcctggttggcattgacaacaagattgaacaagccatggacttg
gtgaagtcccacctcatgtttgccgtgcgagaagaggtggaggtgctgaaggagcagatc
cgagacctggcagagcggaacgctgcattggagcaggagaatggattgctgcgcgccctg
gccagcccggagcagctggcccagctgccatcctcggggctccccaggctcgggccctct
gcacccaatgggccctccatctga

DBGET integrated database retrieval system