KEGG   Mus musculus (mouse): 78830
Entry
78830             CDS       T01002                                 

Gene name
Slc25a12, 2610002D09Rik, AI839531, B230107K20Rik, BB129864
Definition
(RefSeq) solute carrier family 25 (mitochondrial carrier, Aralar), member 12
  KO
K15105  solute carrier family 25 (mitochondrial aspartate/glutamate transporter), member 12/13
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    78830 (Slc25a12)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   78830 (Slc25a12)
SSDB
Motif
Pfam: Mito_carr EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 78830
NCBI-ProteinID: NP_766024
MGI: 1926080
Ensembl: ENSMUSG00000027010
Vega: OTTMUSG00000013185
UniProt: Q8BH59
Position
2; 2 C2
AA seq 677 aa
MAVKVHTTKRGDPHELRNIFLQYASTEVDGEHYMTPEDFVQRYLGLYNDPNSNPKIVQLL
AGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTII
HHHIPFNWDCEFIRLHFGHNRKKHLNYVEFTQFLQELQLEHARQAFALKDKSKSGMISGL
DFSDVMVTIRSHMLTPFVEENLVSAAGGGTSHQVSFSYFNAFNSLLNNMELVRKIYSTLA
GTRKDIEVTKEEFAQSAIRYGQVTPLEIDILYQLADLYNASGRLTLADIERIAPLAEGAL
PYNLAELQRQQSPGLGRPIWLQIAESAYRFTLGSVAGAVGATAVYPIDLVKTRMQNQRGT
GSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRDKFTKR
DGSIPLPAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLQDLGLFGL
YKGAKACFLRDIPFSAIYFPVYAHCKLLLADENGRVGGINLLTAGALAGVPAASLVTPAD
VIKTRLQVAARAGQTTYSGVVDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYEL
LQRWFYIDFGGLKPSGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKF
KSPSVAVAQPKAAAAAQ
NT seq 2034 nt   +upstreamnt  +downstreamnt
atggcggtcaaggtgcatacaaccaaacgaggtgatcctcatgagctgagaaacatattc
ctccagtatgccagcactgaggtggacggggagcattacatgactccagaagacttcgtt
caacgctatcttggcctgtacaacgatccaaacagcaacccaaagattgtgcagctcttg
gcaggagtagctgatcaaaccaaggatgggttgatctcctatcaagagtttttggcattt
gaatctgttctatgtgctccagattccatgttcatagtggctttccaactgtttgacaag
agcggaaatggagaggtgacatttgaaaatgtcaaggagatttttgggcagactattatc
catcaccacatcccttttaactgggactgcgagttcatccggctgcactttgggcacaac
cgcaagaagcacctgaactatgtggaattcactcagttcctccaggaattgcaattggaa
cacgcaaggcaagcctttgcactgaaagacaagagcaaaagcggcatgatctcgggtctg
gatttcagtgacgtcatggtcaccatccggtcccacatgctcactccttttgtggaggag
aacctggtctcagctgccggagggggtacctcacaccaagttagcttctcctacttcaac
gcatttaactccttactcaacaacatggagcttgttcgaaagatctatagcactttagca
ggcacgaggaaagatattgaagtcaccaaggaggaatttgcccagagcgccatacgctat
ggacaggtcactccactagaaattgatatcttgtaccagcttgcagacctatataatgcc
tcagggcgcttgactctggcagacatcgagagaatagctccgctggccgagggggcctta
ccttacaacctggcagagcttcagaggcagcaatctcctggcttgggcagacctatctgg
ctccagattgccgagtctgcatacaggttcactctgggctcagttgctggagctgtgggg
gccactgcggtgtaccccatagacctggtgaagacccggatgcaaaaccagcgtggtacg
ggctctgtggtcggggagctgatgtataaaaacagcttcgactgttttaagaaagtgttg
cgctacgagggtttctttggactgtaccgaggtctgatcccacagctgataggggttgca
ccagaaaaagccattaagctaacagttaatgattttgtccgggacaaatttaccaaaaga
gatggctctatcccactgccggcggaaatccttgctggaggttgcgctggaggctcgcag
gtcatctttaccaaccctctggagatagtgaagatccgcctgcaggtagccggagagatc
accacaggaccgagagtcagtgctctgaatgtgcttcaggacctgggacttttcgggctg
tacaagggtgccaaagcctgtttcctccgagacattcccttctccgcaatctattttccc
gtgtacgctcactgcaaactcctcctggctgatgagaacggacgcgtgggaggcatcaat
ctcctgacagcgggagccttggcaggcgtacctgctgcttctctggtgacccctgctgat
gtcatcaagacaagactgcaagtggccgccagggccggccagacaacatacagcggggtc
gtcgactgtttccgaaagattctccgggaagaagggccctcggcattttggaaagggact
gcagctcgggtgtttcgatcctcacctcagtttggtgtcactctggttacctacgagctt
ctgcagcggtggttttacatagattttggaggcctcaaaccttctggctcagaaccaacg
ccaaagtcccgcatcgcagacctccctcctgccaaccccgatcacatcggtggctacaga
cttgccacggccactttcgctggcattgaaaacaagtttggcctttacctccccaagttt
aagtctcctagcgtagctgtggctcagcccaaggcggcagcagcagcccaatga

DBGET integrated database retrieval system