KEGG   Mus musculus (mouse): 78894
Entry
78894             CDS       T01002                                 

Symbol
Aacs, 2210408B16Rik, SUR5
Name
(RefSeq) acetoacetyl-CoA synthetase
  KO
K01907  acetoacetyl-CoA synthetase [EC:6.2.1.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00280  Valine, leucine and isoleucine degradation
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    78894 (Aacs)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    78894 (Aacs)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    78894 (Aacs)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.16  acetoacetate---CoA ligase
     78894 (Aacs)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   78894 (Aacs)
SSDB
Motif
Pfam: AMP-binding ACAS_N
Other DBs
NCBI-GeneID: 78894
NCBI-ProteinID: NP_084486
MGI: 1926144
Ensembl: ENSMUSG00000029482
Vega: OTTMUSG00000023532
UniProt: Q9D2R0
Position
5; 5 G1.1
AA seq 672 aa
MSKLARLEREEIMECQVMWEPDSKKDTQMDRFRAAVGTACGLALGNYNDLYHWSVRSYMD
FWAEFWKFSGIVYSRMYDEVVDTSKGIADVPEWFRGSRLNYAENLLRHKENDRVALYVAR
EGREEIVKVTFEELRQQVALFAAAMRKMGVKKGDRVVGYLPNSAHAVEAMLAAASIGAIW
SSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHGHLEKLQRVVKGLPDLQRVVLIP
YVLPREKIDISKIPNSVFLDDFLASGTGAQAPQLEFEQLPFSHPLFIMFSSGTTGAPKCM
VHSAGGTLIQHLKEHMLHGNMTSSDILLYYTTVGWMMWNWMVSALATGASLVLYDGSPLV
PTPNVLWDLVDRIGITILGTGAKWLSVLEEKDMKPVETHNLHTLHTILSTGSPLKAQSYE
YVYRCIKSSVLLGSISGGTDIISCFMGQNSSIPVYKGEIQARNLGMAVEAWDEEGKAVWG
ASGELVCTKPIPCQPTHFWNDENGSKYRKAYFSKFPGVWAHGDYCRINPKTGGIIMLGRS
DGTLNPNGVRFGSSEIYNIVEAFDEVEDSLCVPQYNRDGEERVVLFLKMASGHTFQPDLV
KRIRDAIRLGLSARHVPSLILETRGIPYTLNGKKVEVAVKQVMAGRTVEHRGAFSNPETL
DLYRDIPELQDF
NT seq 2019 nt   +upstreamnt  +downstreamnt
atgtccaagctggcgcggctcgagcgcgaggagatcatggagtgccaggtgatgtgggag
cctgacagcaagaaggacacgcagatggaccgcttccgggcggccgtgggtaccgcctgc
ggcctggcgcttgggaattacaatgacttataccactggtctgtccggtcgtatatggac
ttttgggctgagttctggaagttcagtggaatcgtctactcacgcatgtatgatgaggtt
gtggacacatccaaagggattgcagatgtccccgagtggttcagaggcagccgcctcaac
tacgcagagaacctcctgcggcacaaggagaacgacagagtcgccctttacgtggcccgg
gaaggcagagaggagatcgtgaaggtgacttttgaagagctgcggcagcaggtggctctg
ttcgcagctgccatgaggaagatgggcgtgaagaaaggggaccgtgtggtcggctatcta
cccaacagtgcgcatgcggtggaggccatgctggctgctgccagtattggggccatttgg
agttctacctcgccggactttggtgtaaatggtgtcctggaccgcttttctcaaattcag
ccgaaacttatcttctcggtggaggctgttgtctacaatggcaaggagcatggtcacctg
gagaagctgcagcgagttgtgaaaggactgcctgacctgcagcgagtggtgctgatcccc
tatgtcctcccaagggagaagattgacatttccaagatccccaacagtgtgttcctggat
gatttcctggcaagcgggaccggcgcgcaggcgccgcagctcgagtttgagcagctgccc
ttcagccaccctctgttcatcatgttctcctcaggcacgacgggagcgcccaagtgcatg
gtgcactcagccgggggcaccctcatccagcacctgaaggagcacatgctacacggcaac
atgacaagcagtgacatcctgctctactacaccacggtcggctggatgatgtggaactgg
atggtgtcagccctggccacaggagcatccttggtcctgtatgatggctccccgctggtt
ccgacccccaacgtgttgtgggaccttgtggacaggatagggatcaccatcctgggaacg
ggagccaagtggctgtcagtgctggaggagaaggacatgaagccagtggaaactcacaac
ctccacacgctgcacacgatcctgtccaccggctcgccgctgaaagcccagagttacgag
tatgtgtacagatgcatcaagagctccgtgctcctgggctccatctcaggaggcactgac
atcatctcctgtttcatgggccagaactcctctattcctgtgtacaagggtgagatccaa
gcccggaaccttggcatggctgtggaagcctgggacgaggaagggaaggccgtctgggga
gcgagtggcgagctggtgtgcactaagcccattccctgccagcccacgcacttctggaac
gacgagaacggcagcaagtaccggaaggcttacttctccaaattcccaggtgtctgggca
cacggtgactactgcaggatcaaccccaaaacaggaggcattatcatgctgggccgtagt
gatggcaccctcaaccccaatggcgtccgctttggcagctcggagatctacaacatcgtg
gaagccttcgatgaggtggaggacagcctgtgtgtaccccagtacaacagagatggcgag
gagcgggtggtcctgttcctgaagatggcgtccgggcacactttccagcctgacctcgtg
aagcgcatccgagacgccatccgacttggcctgtctgcccgccatgtgcccagcctcatc
ctggagacccgaggcattccatacacactcaatggcaagaaagtggaggtggccgtgaag
caggtgatggctgggaggactgtggagcaccggggggccttctccaaccccgagaccctc
gacctgtaccgggacatccctgagctgcaggacttctga

DBGET integrated database retrieval system