KEGG   Mus musculus (mouse): 78896
Entry
78896             CDS       T01002                                 

Gene name
Ecrg4, 1500015O10Rik, aug
Definition
(RefSeq) ECRG4 augurin precursor
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Augurin DUF1700
Other DBs
NCBI-GeneID: 78896
NCBI-ProteinID: NP_077245
MGI: 1926146
Ensembl: ENSMUSG00000026051
Vega: OTTMUSG00000020869
UniProt: Q99LS0
Position
1; 1 C1.1
AA seq 148 aa
MSTSSARPAVLALAGLALLLLLCLGPDGISGNKLKKMLQKREGPVPSKTNVAVAENTAKE
FLGGLKRAKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDVNYWLNRNRNGHDYYGDYYQ
RHYDEDAAIGPHSRESFRHGASVNYNDY
NT seq 447 nt   +upstreamnt  +downstreamnt
atgagcacctcgtctgcgcggcctgcagtcctggcccttgccgggctggctctgctcctt
ctgctgtgcctgggtccagatggcataagtggaaacaaactcaagaagatgctccagaaa
cgagaaggacctgtcccgtcaaagactaatgtagctgtagccgagaacacagcaaaggaa
ttcctaggtggcctgaagcgtgccaaacgacagctgtgggaccgtacgcggcctgaggta
cagcagtggtaccagcagttcctctacatgggctttgatgaggctaaatttgaagatgat
gtcaactattggctaaacagaaatcgaaacggccatgactactatggtgactactaccag
cgtcattatgatgaagatgcggccattggtccccacagccgggaaagcttcaggcatgga
gccagtgtcaactataatgactattaa

DBGET integrated database retrieval system