KEGG   Mus musculus (mouse): 78903
Entry
78903             CDS       T01002                                 

Gene name
Wrnip1, 4833444L21Rik, WH, WHIP, Wrnip
Definition
(RefSeq) Werner helicase interacting protein 1
  KO
K07478  putative ATPase
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    78903 (Wrnip1)
Motif
Pfam: MgsA_C AAA_assoc_2 AAA RuvB_N zf-WRNIP1_ubi AAA_14 Sigma54_activat AAA_5 DUF815 AAA_16 AAA_22 ATPase_2 AAA_2 Mg_chelatase IstB_IS21 Viral_helicase1 Rad17 TIP49 Bac_DnaA AAA_30 Sigma54_activ_2 RNA_helicase AAA_7 NB-ARC ATP-synt_ab ResIII AAA_18 ABC_tran AAA_19 TniB AAA_33 AAA_3 NACHT NTPase_1 DNA_pol3_delta2 AAA_28 Sgf11 AAA_11 AAA_24 Zeta_toxin
Other DBs
NCBI-GeneID: 78903
NCBI-ProteinID: NP_084491
MGI: 1926153
Ensembl: ENSMUSG00000021400
Vega: OTTMUSG00000000693
UniProt: Q91XU0
Position
13; 13 A3.2
AA seq 660 aa
MEVSGPEDDPFLSQLHQVQCPVCQQMMPAAHINSHLDRCLLLHPAGHAEPAAGSHRAGER
AKGPSPPGAKRRRLSESSALKQPATPTAAESSEGEGEEGDDGGETESRESYDAPPTPSGA
RLIPDFPVARSSSPARKGMGKRPAAAAAAGSASPRSWDEAEAQEEEEAGVDGDGDADVDG
EDDPGHWDADAADASFGVSAGRAHPRALAAEEIRQMLEGKPLADKMRPDTLQDYIGQSRA
VGQETLLRSLLEANEIPSLILWGPPGCGKTTLAHIIANNSKKHSIRFVTLSATNAKTNDV
RDVIKQAQNEKSFFKRKTILFIDEIHRFNKSQQDTFLPHVECGTITLIGATTENPSFQVN
AALLSRCRVIVLEKLPVEAMVTILMRAINSLGIHVLDSSRPTDPLSHSSNCSSEPSVFIE
DKAVDTLAYLSDGDARTGLNGLQLAVLARLSSRKVFCKKSGQTYSPSRVLITENDVKEGL
QRSHILYDRAGEEHYNCISALHKAMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFASE
DIGLADPSALAQAVAAYQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKACLR
SHQGPLPPVPLHLRNAPTRLMKDLGYGKGYKYNPMYSEPVDQDYLPEELRGVDFFKQRRC
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggaggtgagcgggccggaagacgaccccttcctgtcgcagttgcaccaggtgcagtgc
ccagtgtgccagcagatgatgcccgccgcgcacatcaattcgcacctggaccgctgcctg
ctgctgcaccctgcggggcacgcggagccagcggccggctctcaccgcgctggggagcgg
gccaaggggccctcgccacccggcgccaagaggcgtcgactgtcggagagctcggcgctg
aagcagcccgccaccccgacggcggccgaaagcagcgaaggcgagggcgaggagggcgat
gacggcggcgagaccgagagccgtgagagctacgacgcaccgcccacgcccagcggtgcg
cgccttatcccggacttcccggtggcccgctccagcagccccgccagaaagggtatgggg
aagagaccagcggctgcagccgccgcaggcagcgcatccccgcgcagctgggatgaggcg
gaggcgcaggaggaggaggaggcgggggtggacggcgatggcgacgcggacgtggacggt
gaggacgatcccgggcactgggatgcggacgccgccgacgcctcgttcggagtcagcgcg
ggccgcgcgcatccccgggcgctggcggcggaggagatccgacagatgctggagggcaag
ccgctggctgacaagatgcgtccagacacgctgcaggactacatcgggcagagtagggcc
gtagggcaggagactctgctccgctcgctactggaggccaatgagatcccttcgctcatc
ttgtggggcccgccaggttgcggtaagaccaccttggctcacatcatagccaacaacagc
aagaagcacagcataaggtttgtgacattatctgcaacaaatgccaagacaaatgatgtg
cgagatgtcataaagcaggctcagaatgagaagagctttttcaaaaggaaaaccatcctt
tttattgatgagattcatcgcttcaataaatctcagcaggacactttccttcctcacgtg
gagtgcgggacaatcacgctgattggtgcgaccactgagaacccttccttccaagtcaac
gccgcccttctgagccgctgtcgggtaattgttcttgagaagcttccagtagaggcaatg
gtgacgattttaatgagagcaatcaactcactgggaatccatgtcctagactccagccgt
cctactgaccctctgagccacagcagcaactgcagctctgagccctctgtcttcatagaa
gataaagcagtggacactctggcttacctcagtgatggtgatgcccggacgggcttgaat
ggactgcaactggcagtgctggccaggttaagctctaggaaggtgttctgtaagaagagc
ggtcaaacctattctcctagtcgagttctgatcactgagaatgatgtgaaagaaggccta
cagcggtcccacattttatatgaccgtgcaggagaagagcactacaactgcatctctgcc
ctacacaaggctatgcgtggctctgaccagaatgcttccctgtattggctggcccggatg
cttgagggaggagaggacccactctatgtggccaggaggctggtaaggtttgccagcgag
gacatcggcctggcagatccatcagcattagcacaagcagttgctgcctaccaaggctgt
cactttataggcatgcccgagtgtgaggtgcttctggcccagtgtgtggtctattttgcc
agagccccaaagtccattgaggtgtacagtgcctataacaatgtaaaagcctgtctgcgg
agtcaccaggggcccctgcctcctgtacccctgcacctgaggaacgcgcccaccaggctg
atgaaggatttgggctatggcaaagggtacaagtacaaccccatgtacagtgagcctgtg
gaccaggactacctgcctgaggagctgagaggagttgacttcttcaagcagaggcggtgt
tga

DBGET integrated database retrieval system