KEGG   Mus musculus (mouse): 78914
Entry
78914             CDS       T01002                                 

Gene name
Nadsyn1, 9130012B15Rik
Definition
(RefSeq) NAD synthetase 1
  KO
K01950  NAD+ synthase (glutamine-hydrolysing) [EC:6.3.5.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00760  Nicotinate and nicotinamide metabolism
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Module
mmu_M00912  NAD biosynthesis, tryptophan => quinolinate => NAD
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    78914 (Nadsyn1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.1  NAD+ synthase (glutamine-hydrolysing)
     78914 (Nadsyn1)
SSDB
Motif
Pfam: CN_hydrolase NAD_synthase
Other DBs
NCBI-GeneID: 78914
NCBI-ProteinID: NP_084497
MGI: 1926164
Ensembl: ENSMUSG00000031090
Vega: OTTMUSG00000025932
UniProt: Q711T7
Position
7; 7 F5
AA seq 725 aa
MGRKVTVATCALNQWALDFEGNFQRILKSIQIAKGKGARYRLGPELEICGYGCWDHYHES
DTLLHSLQVLAALLDSPVTQDIICDVGMPIMHRNVRYNCRVIFLNRKILLIRPKMALANE
GNYRELRWFTPWTRSRQTEEYVLPRMLQDLTKQKTVPFGDVVLATQDTCVGSEICEELWT
PRSPHIDMGLDGVEIITNASGSHHVLRKAHTRVDLVTMATSKNGGIYLLANQKGCDGDRL
YYDGCAMIAMNGSIFAQGTQFSLDDVEVLTATLDLEDVRSYKAEISSRNLEATRVSPYPR
VTVDFALSVSEDLLEPVSEPMEWTYHRPEEEISLGPACWLWDFLRRSKQAGFFLPLSGGV
DSAASACIVYSMCCLVCDAVKSGNQQVLTDVQNLVDESSYTPQDPRELCGRLLTTCYMAS
ENSSQETHSRATKLAQLIGSYHINLSIDTAVKAVLGIFSLMTGKLPRFSAHGGSSRENLA
LQNVQARIRMVLAYLFAQLSLWSRGARGSLLVLGSANVDESLLGYLTKYDCSSADINPIG
GISKTDLRAFVQFCAERFQLPVLQTILSAPATAELEPLADGQVSQMDEEDMGMTYAELSI
FGRLRKVAKAGPYSMFCKLLNMWRDSYTPTQVAEKVKLFFSKYSMNRHKMTTLTPAYHAE
NYSPDDNRFDLRPFLYNTRWPWQFLCIDNQVLQLERKASQTREEQVLEHFKEPSPIWKQL
LPKDP
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgggccggaaagtgaccgtggccacctgtgcactcaatcagtgggccctggactttgag
ggcaatttccagaggattttaaagagtattcaaattgccaaaggcaaaggtgcaagatac
aggcttggaccagaactagaaatatgcggctatggatgttgggatcattatcacgaatca
gacactctcctgcattcgctccaagttctggctgctcttctggactctccggtcactcag
gacatcatctgtgatgtggggatgcctataatgcaccggaatgttcgctacaactgcaga
gtcatctttctcaacaggaagatcctgctcatcagacccaagatggccttggccaacgaa
ggcaactaccgggaactgcgctggtttaccccctggaccaggagccgacaaactgaggaa
tatgtcctccctcggatgttacaggacctgacaaagcagaaaactgtgccctttggagat
gtggtactggccacccaagacacctgtgtcgggagtgagatctgtgaggagctctggaca
ccacgcagcccccacatcgacatgggcctggatggtgtggagatcattaccaatgcctcg
ggcagccaccacgtgctccgcaaagcccataccagagtggatctggtaaccatggccacc
tccaagaatggtggcatctacctgctggccaaccagaagggctgtgatggtgaccgtctc
tactacgatggctgtgccatgattgctatgaacgggagcatctttgcccagggcactcag
ttctcattggatgatgtggaggttctcactgccaccctggacctggaggacgttaggagc
tacaaggcagagatctcatctcggaacctggaggcaaccagggtgagcccatatccccgg
gtgacggtggactttgccctttcggtcagtgaagacttgttggagccagtgtcagagcct
atggaatggacataccacaggcctgaggaggagataagcctcggccctgcctgctggctc
tgggacttccttcgacggagcaaacaggccgggtttttccttcccctgagtggtggtgtg
gacagtgcagccagcgcctgtatcgtctactccatgtgctgcctggtctgcgatgctgtg
aagagcggaaatcagcaagtgctgacagacgtccagaacctggtggacgagagcagctac
acccctcaggatccccgggagctctgcggacggctgctcactacttgttacatggccagc
gagaactcctcccaggagacccacagcagagccacaaaactggctcagctgattggaagc
taccacatcaatctgagcatcgacactgctgtgaaggctgtcttgggcatcttcagcctg
atgaccgggaagttgcctcggttctcagcccacggagggagcagcagggagaacctggcc
ttgcagaatgtgcaggctcggattaggatggtccttgcctacctgtttgctcagctgagc
ctctggtctcggggtgctcgaggaagccttcttgtgcttggatctgccaatgtggatgag
agtctcctcggctacctgaccaagtacgactgctccagtgcggacatcaaccccataggc
ggcatcagcaagacggacctgagagcctttgtccagttttgcgcagagcgcttccagctt
cctgttctgcagaccatcctgtcagcaccggccactgcagagctggagcccttagctgat
gggcaggtgtctcagatggatgaggaagacatggggatgacgtacgcagaactctccatc
ttcggcaggctccggaaggtcgccaaggcaggcccctacagcatgttctgcaaactgctc
aacatgtggagagacagctatacaccaacacaggtagctgagaaggtgaagctatttttc
tcaaagtactccatgaacaggcacaagatgacaaccctcacaccagcatatcatgctgaa
aactacagtcctgacgacaacaggtttgacctgagaccctttctgtataacacgagatgg
ccctggcagttcctctgcattgacaaccaggttctacagcttgagaggaaagcatcgcag
acccgggaagaacaggtcctggagcacttcaaagagccatcacctatatggaaacagctc
ctccccaaggacccctaa

DBGET integrated database retrieval system