KEGG   Mus musculus (mouse): 78929
Entry
78929             CDS       T01002                                 

Gene name
Polr3h, 5031409G22Rik, RP, RPC8
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide H
  KO
K03022  DNA-directed RNA polymerase III subunit RPC8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    78929 (Polr3h)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    78929 (Polr3h)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    78929 (Polr3h)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     78929 (Polr3h)
SSDB
Motif
Pfam: RNA_pol_Rbc25 SHS2_Rpb7-N
Other DBs
NCBI-GeneID: 78929
NCBI-ProteinID: NP_084505
MGI: 1926179
Ensembl: ENSMUSG00000022476
UniProt: Q9D2C6
Position
15; 15 E1
AA seq 204 aa
MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVF
PGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKF
DEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSAEAASSSEELPKK
EAPYTLVGSISEPGLGLLSWWTSN
NT seq 615 nt   +upstreamnt  +downstreamnt
atgttcgtgctggtggagatggtggacaccgtgcgcatacccccgtggcagtttgagcgg
aaactcaacgattccattgctgaggagctgaacaagaaattggccaacaaggtcgtatac
aacgtgggactctgcatctgtctgtttgatatcaccaagctggaggacgcctatgtgttc
ccaggggatggagcatcccacaccaaagtccatttccgctacgtggtgtttcaccccttc
ctggatgagatcctcattgggaagatcaaaggctgcagcccagagggtgtgcacgtctct
ttagggttctttgatgacattctcatcccccctgagtcactgcagcagcctgccaagttt
gatgaagcggagcaagtgtgggtgtgggagtacgagacggaggaaggagcgcatgacctg
tacatggacactggggaggagatccgcttcagggtggtggatgagagctttgtggacaca
tcccccacaggacccagttccgccgaggctgcctcttcaagcgaggagctgcccaagaag
gaagcaccatatacacttgtgggatctatcagtgagccaggactaggccttctctcctgg
tggacgagcaactag

DBGET integrated database retrieval system