KEGG   Mus musculus (mouse): 78937Help
Entry
78937             CDS       T01002                                 

Gene name
Avl9, 5830411G16Rik, D730049P16Rik, mKIAA0241
Definition
(RefSeq) AVL9 cell migration associated
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Avl9 DUF2347 Afi1 SPA DENN
Motif
Other DBs
NCBI-GeneID: 78937
NCBI-ProteinID: NP_084511
MGI: 1926187
Ensembl: ENSMUSG00000029787
Vega: OTTMUSG00000039874
UniProt: Q80U56
Position
6; 6 B3
AA seq 649 aa AA seqDB search
MEKSGRESDGAPCGPVLHIVVVGFHHKKGCQVEFSYPPLIPGDGHDSHTLPEEWKYLPFL
ALPDGAHNYQEDTVFFHLPPRNGNGATVYGISCYRQIEAKALKVRQADITRETVQKSVCV
LSKLPLYGLLQAKLQLITHAYFEEKDFSQISILKELYEHMNSSLGGASLEGSQVYLGLSP
RDLVLHFRHKVLILFKLILLEKKVLFYISPVNRLVGALMTVLSLFPGMIEHGLSDCSQYR
PRKSMSEDAGPQESNPSADDFTSESTSDVLNTSLETVTRVMAVNHGEDAVPKTEKPYFQV
EGNNNKGQEPSDSGRYLELPPRPSPESSESDWETLDPSVLEDASLKEREQMGSDQTHLFQ
KDSLPSDSPPITVQPQANNRQVVLIPGLISGLEEDQYGMPLAIFTKGYLCLPYMALQQHH
LLSDVTVRGFVAGATNILFRQQKHLSDAIVEVEEALIQIHDPELRKLLNPTTADLRFADY
LVRHVTENRDDVFLDGTGWEGGDEWIRAQFAVYIHALLAATLQLDNEKMLSDYGTTFVAA
WKNTHNYRVWNSNKHPALSEINPNHPFQGQYSVSDMKLRFSHSVQNSERGKKIGSVMVTT
SRNVVQTGKAVGQSVGGAFSSAKTAMSSWLSTFTTSTPQSLPEPPNGKP
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtctgggcgtgagagtgacggcgccccctgcgggcctgtcctgcacatcgtg
gtggtcggctttcaccacaagaagggctgccaggttgaattctcttacccaccactaatt
ccaggagatggacatgatagccacactttacctgaagaatggaagtacttgcctttcctt
gccttaccagatggtgcacataactatcaggaagatactgtgttttttcacttgccaccc
agaaatggaaatggagccacagtatatggtatctcttgttatcgacaaattgaagccaag
gcattaaaagtgaggcaagccgacatcaccagagagactgttcagaaaagtgtctgtgtt
ttaagcaagctgcctctttatggcttacttcaagcaaaactccaactcattacacatgca
tattttgaagaaaaagatttttcccaaatttccattctaaaggagctctatgaacatatg
aacagttccttgggaggggcctcattagaaggatcgcaggtgtatcttggtttgtctcct
cgagatcttgtccttcattttcgacacaaggtcttgatcctgtttaagctaattcttctt
gaaaagaaggttctgttttacatttctccagtgaatagattggtgggtgcactaatgact
gtgttatccctttttccaggcatgattgagcatggcctcagtgactgttctcagtataga
cctcgaaagagtatgtctgaagatgctggacctcaggaaagtaatccctctgcagatgat
tttacttctgagtctacttctgacgtcttaaataccagcttggaaactgtcacaagagtc
atggcagtaaaccatggcgaagatgctgtgcccaagacggagaagccttacttccaagta
gaaggtaacaacaacaaaggacaggaacccagtgattctggccgatatttggaacttcca
ccccgtccatctccagagtcttcagaaagtgactgggaaacgttggatcctagtgtctta
gaggatgccagcttgaaagaaagggagcagatggggtcagaccagacacacttattccaa
aaggactctctgccctcggacagtcctccaattactgtacagcctcaagctaataacagg
caggtggtcctgataccagggctcatttctggtttggaagaagaccaatatggcatgcct
ctggccatctttacaaagggatatctgtgtttgccttacatggcattgcagcagcatcat
cttctctctgatgtcactgttcggggatttgtggctggagctactaacatccttttccga
caacagaagcacctcagtgatgccattgtggaagtggaagaagcactgatccagatccac
gatccagaacttaggaagctgcttaacccaacgacggctgacctaaggttcgcagactac
ctggtgaggcacgtgactgagaaccgggacgatgtcttcctggatggcaccggctgggag
ggtggtgacgaatggatccgggcccagtttgcagtctacatccacgctctcctggctgct
acactgcagttagataatgaaaagatgttatcagactatggaacaacttttgttgccgcc
tggaagaatactcacaactacagggtatggaacagcaataagcatccggcactttcagag
ataaatccaaaccatccttttcaaggccagtactccgtgtcagacatgaaactcagattc
tcacattctgttcagaatagtgaacgtggcaaaaaaattggcagtgtcatggtcacaacc
agccggaatgtggtacaaacaggaaaagccgttggccaatcagttggaggagctttttcc
agtgcaaagacagctatgtcttcatggctatctactttcaccacatccacccctcagagt
cttcctgagccacccaatgggaagccctga

DBGET integrated database retrieval system