KEGG   Mus musculus (mouse): 78943
Entry
78943             CDS       T01002                                 

Gene name
Ern1, 9030414B18Rik, AI225830, C85377, Ir, Ire, Ire1a, Ire1alpha, Ire1p
Definition
(RefSeq) endoplasmic reticulum (ER) to nucleus signalling 1
  KO
K08852  serine/threonine-protein kinase/endoribonuclease IRE1 [EC:2.7.11.1 3.1.26.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04140  Autophagy - animal
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    78943 (Ern1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    78943 (Ern1)
  09143 Cell growth and death
   04210 Apoptosis
    78943 (Ern1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    78943 (Ern1)
   05012 Parkinson disease
    78943 (Ern1)
   05014 Amyotrophic lateral sclerosis
    78943 (Ern1)
   05016 Huntington disease
    78943 (Ern1)
   05017 Spinocerebellar ataxia
    78943 (Ern1)
   05022 Pathways of neurodegeneration - multiple diseases
    78943 (Ern1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    78943 (Ern1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    78943 (Ern1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     78943 (Ern1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     78943 (Ern1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  IRE family
   78943 (Ern1)
SSDB
Motif
Pfam: Pkinase Ribonuc_2-5A PK_Tyr_Ser-Thr PQQ_2 PQQ Pkinase_fungal Kdo APH
Other DBs
NCBI-GeneID: 78943
NCBI-ProteinID: NP_076402
MGI: 1930134
Ensembl: ENSMUSG00000020715
Vega: OTTMUSG00000003414
UniProt: Q9EQY0
Structure
PDB: 
4PL3 4PL4 4PL5

Position
11; 11 E1
AA seq 977 aa
MPARWLLLLLALLLPPPGPGSFGRTSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKE
DPVLQVPTHVEEPAFLPDPNDGSLYTLGGKNNEGLTKLPFTIPELVQASPCRSSDGILYM
GKKQDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNAT
YFDYAASLPEDDVDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQGEVLR
KVVHINVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASPS
MVHEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDLKFDPGLKGKSKLNYLRNY
WLLIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEKRSFEEVINIVGQTSDNTPTTV
SQDVEEKLARAPAKPEAPVDSMLKDMATIILSTFLLVGWVAFIITYPLSVHQQRQLQHQQ
FQKELEKIQLLQQQQLPFHPHGDLTQDPEFLDSSGPFSESSGTSSPSPSPRASNHSLHPS
SSASRAGTSPSLEQDDEDEETRMVIVGKISFCPKDVLGHGAEGTIVYKGMFDNRDVAVKR
ILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVEQKDFAH
LGLEPITLLHQTTSGLAHLHSLNIVHRDLKPHNILLSMPNAHGRIKAMISDFGLCKKLAV
GRHSFSRRSGVPGTEGWIAPEMLSEDCKDNPTYTVDIFSAGCVFYYVISEGNHPFGKSLQ
RQANILLGACNLDCFHSDKHEDVIARELIEKMIAMDPQQRPSAKHVLKHPFFWSLEKQLQ
FFQDVSDRIEKEALDGPIVRQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDL
LRAMRNKKHHYRELPVEVQETLGSIPDDFVRYFTSRFPHLLSHTYQAMELCRHERLFQTY
YWHEPTEPQPPVIPYAL
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgccggcccggtggctgttgctcctgctggcgctgctgctaccgccgcccggccccggg
agttttggaagaaccagcacagttacactgcctgagaccttgttgtttgtctcgaccctg
gatggaagcttgcatgctgttagcaagaggacgggctccatcaagtggactttaaaagaa
gatccagtcctgcaggtcccaacacacgtggaagagccggctttcctcccagatcccaat
gatggcagtctgtacacacttggaggcaagaacaacgaaggcctgacgaaacttcccttt
accatcccagaattggttcaggcctccccatgccgaagttcagatggaatcctctacatg
ggtaaaaagcaagatatttggtatgttatcgacctcctgactggcgagaagcagcagact
ttgtcatcggcctttgctgatagtctctgcccatcaacttcccttctatatcttggacgg
acagaatacaccatcaccatgtatgacaccaagacccgggagctccgctggaatgccacc
tattttgactatgcagcctcactgccggaagacgacgtggactacaagatgtcccacttt
gtgtccaatggcgatggactggtggtaactgtggacagtgaatctggggatgtcctgtgg
atccaaaactatgcctctcctgtggtggccttctacgtctggcagggggaggtcctgaga
aaggtggtgcacatcaacgttgctgtggagactctacgctacttgaccttcatgtctggg
gaagtggggcgcatcaccaagtggaagtatccattccccaaggagacagaggccaagagc
aagctaacgcctactctgtatgttgggaagtattccaccagcctctatgcctctccctca
atggtgcatgagggggttgctgtcgtgcctcgaggcagcactcttcctttgctggaaggc
ccccagacagatggcgtcaccattggagacaaaggagagtgtgtgatcactcccagcaca
gacctcaagtttgaccctggactcaaagggaagagcaagctgaactacttgaggaattac
tggcttctcataggacaccatgaaactcctctgtctgcatccaccaagatgctggagaga
tttcctaacaacctgcccaaacatcgagaaaatgtgattcctgctgattcagaaaaaagg
agctttgaggaagttatcaacatagttggccagacttcagacaacacaccgaccaccgta
tctcaggatgtggaggagaagctcgctcgcgcccctgccaagcctgaggcccccgtggac
tccatgctcaaggacatggctaccattatcctgagcaccttcctgctggttggatgggtg
gcgttcatcatcacttaccccctgagcgtgcatcagcagcgtcagctccagcaccaacag
ttccagaaggagctggagaagattcagctcctgcagcagcagcagctgcccttccaccca
cacggagaccttacccaggaccctgagttcctggattcatctggccccttctcagagagc
tctggcaccagcagccccagcccatcccccagagcctccaaccactccctccaccccagc
agctctgcctccagggccggcaccagcccctctctggagcaggatgatgaggatgaggaa
accagaatggtgattgttgggaaaatttcattctgccccaaggatgtcctgggtcatgga
gctgagggcacaattgtatacaaaggtatgtttgacaaccgagatgtggccgtgaagagg
atcctccctgagtgttttagctttgccgaccgtgaggtccagctgcttcgagaatcagac
gagcacccaaatgtgatccgctacttttgcacagagaaggaccggcagttccagtacatt
gctatcgagctgtgtgcagccaccctacaagagtatgtggagcagaaggactttgcccac
cttggcctcgagcccatcaccctgcttcatcagaccacctcaggcctggcacacctgcat
tctctcaacattgttcacagagacctgaagccccacaacattctcctctccatgcccaac
gcacatggcaggatcaaggcgatgatctctgactttggcctctgcaagaagctggcagtg
ggcaggcacagtttcagccgccgttcaggggtacctggcactgaagggtggatcgcccca
gagatgctgagtgaagactgtaaggacaaccctacctacacggtggacatcttttctgca
ggctgtgtcttttactatgtcatctctgagggcaaccatccttttggcaaatccttgcag
cggcaggccaacatcctcctgggcgcctgcaaccttgactgtttccactcagacaagcat
gaggacgtcattgctcgtgaattgatagagaaaatgattgctatggatccccagcagcgt
ccctctgcaaagcacgtgctgaaacaccccttcttctggagcctggagaagcagctccag
tttttccaggatgtaagtgaccgaatagaaaaggaggccttggacggtccaatcgtacgg
cagttggagagaggcgggagagctgtggtcaagatggactggcgggagaacatcactgtc
cccctgcagacagatctgcgcaaattcagaacctacaaaggtggctctgtgagagacctc
ctccgagccatgagaaacaagaaacaccactaccgggagctccccgtggaggttcaggag
acgctgggctccatcccggatgactttgtgcgctacttcacttcccgcttcccccacctc
ctctctcacacctaccaagccatggagctgtgcagacatgagagactctttcagacctac
tactggcacgagcccacagaaccccagcctccagtgattccatatgccctctga

DBGET integrated database retrieval system